KEGG   Bacillus cytotoxicus NVH 391-98: Bcer98_0067Help
Entry
Bcer98_0067       CDS       T00560                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bcy  Bacillus cytotoxicus NVH 391-98
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bcy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
77823..78656
Genome map
AA seq 277 aa AA seqDB search
MKWNYDLRCGEYTLNLNEKTLVMGILNVTPDSFSDGGSYNELETAVRHAKEMVSSGADLI
DIGGESTRPGFAKVSVEEELARVLPVIQAVSKKVNVPISIDTYKAEVAKQAIEAGAHIIN
DIWGAKAEPKIAEVAAHYDVPIILMHNRDHTNYRNVMSDMIADLYESVKIAKNAGVRDEN
IILDPGIGFAKTPEQNLEVMRNLEQLNVLGYPVLLATSRKSFIGHVLDLPVEERIEGTGA
SVCLGIAKGCEMIRVHDVKEMARMAKMMDAMIGKGGK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatggaactatgatttgcgctgtggtgaatatacattaaatttaaatgaaaaaaca
ttagtcatggggattttgaatgtaacaccagattcattctctgatggcggaagttataat
gaattagaaacagctgttcgccatgcgaaggaaatggtgagttctggtgcggatttaatt
gatataggtggagaatcaacgcgcccaggctttgcaaaagtttcagtagaagaggaatta
gcacgtgtattacccgttatacaagctgtttcgaagaaagtgaatgtgcctatttctatt
gatacttataaagcagaggtagcaaagcaggctattgaagctggagctcacattattaat
gatatttggggagcgaaagcggagccgaaaatcgcagaagtagcagctcattatgatgta
ccgattattttaatgcacaatcgtgatcatacaaattatcgtaatgtaatgtccgatatg
attgcagatttatatgagagtgttaagattgcgaaaaatgcaggcgtacgtgatgaaaac
attattttagatccaggtattggttttgctaaaacacctgaacaaaatttagaagttatg
cgtaatttagagcaattgaatgtattagggtatccggttcttcttgcaacttcaaggaag
tcttttatcggacatgttttagatttaccggtagaagagcgtattgaaggaacgggagca
tcagtttgccttgggattgctaaaggttgtgaaatgattcgtgttcatgatgtgaaagaa
atggcccgtatggcaaagatgatggatgcaatgattggcaaggggggaaagtga

DBGET integrated database retrieval system