KEGG   Bacillus cytotoxicus: Bcer98_0110Help
Entry
Bcer98_0110       CDS       T00560                                 

Definition
(GenBank) ribosomal protein S3
  KO
K02982  
small subunit ribosomal protein S3
Organism
bcy  Bacillus cytotoxicus
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Bcer98_0110
Ribosome [BR:bcy03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    Bcer98_0110
  Archaea
    Bcer98_0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
130744..131403
Genome map
AA seq 219 aa AA seqDB search
MGQKVNPVGLRVGVIRDWESRWFAEKDYATLLHEDIKIREYITARLKDSSVSKVEIERAA
NRVNVTIHTAKPGMVIGKGGTEVEALRKALNQLTGKRVHINILEVKKADLDAKLVAENIA
RQLENRVSFRRAQKQVIQRAMRAGAKGIKTQVSGRLGGADIARAESYSEGTVPLHTLRAD
IDYATAEADTTYGKLGVKVWIYRGEVLPSKKKASEEGGK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaaaggttaatccagtcggtcttcgtgtcggtgttattcgtgattgggaatct
cgttggttcgcagaaaaagattacgctacacttcttcatgaagacatcaaaattcgtgaa
tacatcacagctcgcttaaaagattcttctgtttctaaagtagaaatcgagcgtgctgca
aatcgtgtaaatgttacaattcacactgcaaaacctggtatggtaattggtaaaggtggt
actgaagttgaagcgcttcgtaaagctcttaaccaattaacaggcaagcgtgtacacatc
aacatcttagaagttaagaaagcagatcttgatgctaaattagtagcggaaaacattgct
cgtcaattagaaaatcgtgtatctttccgtcgtgctcaaaagcaagttatccaacgtgca
atgcgtgctggcgctaaaggtattaaaacacaagtttctggtcgtcttggcggagcagat
atcgctcgtgcagaatcttacagtgaaggaactgttccacttcatacacttcgcgctgat
attgactatgcaacagctgaagctgatacaacatacggtaaattaggcgtaaaagtatgg
atctaccgtggagaagttcttccttcaaaaaagaaagcttctgaggaaggaggaaaataa

DBGET integrated database retrieval system