KEGG   Bacillus cytotoxicus NVH 391-98: Bcer98_0110Help
Entry
Bcer98_0110       CDS       T00560                                 

Gene name
rpsC
Definition
30S ribosomal protein S3
Orthology
K02982  
small subunit ribosomal protein S3
Organism
bcy  Bacillus cytotoxicus NVH 391-98
Pathway
Ribosome
Module
Ribosome, bacteria
Class
Genetic Information Processing; Translation; Ribosome [PATH:bcy03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
130744..131403
Genome map
AA seq 219 aa AA seqDB search
MGQKVNPVGLRVGVIRDWESRWFAEKDYATLLHEDIKIREYITARLKDSSVSKVEIERAA
NRVNVTIHTAKPGMVIGKGGTEVEALRKALNQLTGKRVHINILEVKKADLDAKLVAENIA
RQLENRVSFRRAQKQVIQRAMRAGAKGIKTQVSGRLGGADIARAESYSEGTVPLHTLRAD
IDYATAEADTTYGKLGVKVWIYRGEVLPSKKKASEEGGK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaaaggttaatccagtcggtcttcgtgtcggtgttattcgtgattgggaatct
cgttggttcgcagaaaaagattacgctacacttcttcatgaagacatcaaaattcgtgaa
tacatcacagctcgcttaaaagattcttctgtttctaaagtagaaatcgagcgtgctgca
aatcgtgtaaatgttacaattcacactgcaaaacctggtatggtaattggtaaaggtggt
actgaagttgaagcgcttcgtaaagctcttaaccaattaacaggcaagcgtgtacacatc
aacatcttagaagttaagaaagcagatcttgatgctaaattagtagcggaaaacattgct
cgtcaattagaaaatcgtgtatctttccgtcgtgctcaaaagcaagttatccaacgtgca
atgcgtgctggcgctaaaggtattaaaacacaagtttctggtcgtcttggcggagcagat
atcgctcgtgcagaatcttacagtgaaggaactgttccacttcatacacttcgcgctgat
attgactatgcaacagctgaagctgatacaacatacggtaaattaggcgtaaaagtatgg
atctaccgtggagaagttcttccttcaaaaaagaaagcttctgaggaaggaggaaaataa

DBGET integrated database retrieval system