KEGG   Bacillus cytotoxicus: Bcer98_0110Help
Entry
Bcer98_0110       CDS       T00560                                 

Gene name
rpsC
Definition
30S ribosomal protein S3
Orthology
K02982  
small subunit ribosomal protein S3
Organism
bcy  Bacillus cytotoxicus
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Bcer98_0110 (rpsC)
Ribosome [BR:bcy03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    Bcer98_0110 (rpsC)
  Archaea
    Bcer98_0110 (rpsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
130744..131403
Genome map
AA seq 219 aa AA seqDB search
MGQKVNPVGLRVGVIRDWESRWFAEKDYATLLHEDIKIREYITARLKDSSVSKVEIERAA
NRVNVTIHTAKPGMVIGKGGTEVEALRKALNQLTGKRVHINILEVKKADLDAKLVAENIA
RQLENRVSFRRAQKQVIQRAMRAGAKGIKTQVSGRLGGADIARAESYSEGTVPLHTLRAD
IDYATAEADTTYGKLGVKVWIYRGEVLPSKKKASEEGGK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaaaggttaatccagtcggtcttcgtgtcggtgttattcgtgattgggaatct
cgttggttcgcagaaaaagattacgctacacttcttcatgaagacatcaaaattcgtgaa
tacatcacagctcgcttaaaagattcttctgtttctaaagtagaaatcgagcgtgctgca
aatcgtgtaaatgttacaattcacactgcaaaacctggtatggtaattggtaaaggtggt
actgaagttgaagcgcttcgtaaagctcttaaccaattaacaggcaagcgtgtacacatc
aacatcttagaagttaagaaagcagatcttgatgctaaattagtagcggaaaacattgct
cgtcaattagaaaatcgtgtatctttccgtcgtgctcaaaagcaagttatccaacgtgca
atgcgtgctggcgctaaaggtattaaaacacaagtttctggtcgtcttggcggagcagat
atcgctcgtgcagaatcttacagtgaaggaactgttccacttcatacacttcgcgctgat
attgactatgcaacagctgaagctgatacaacatacggtaaattaggcgtaaaagtatgg
atctaccgtggagaagttcttccttcaaaaaagaaagcttctgaggaaggaggaaaataa

DBGET integrated database retrieval system