KEGG   Bacillus cytotoxicus NVH 391-98: Bcer98_0147Help
Entry
Bcer98_0147       CDS       T00560                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bcy  Bacillus cytotoxicus NVH 391-98
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bcy01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bcy00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
159090..159983
Genome map
AA seq 297 aa AA seqDB search
MKKEISIIGVPMDLGQLRRGVDMGASAIRYAGVIERIEHIGYDVKDIGDIHIDREKEVDG
NTKLRNLTQVVKVCNELASKVDHIIEEDRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHPSLVNLYEAYPKVKKENIVIIGARALDEGE
KEFIRNEGIKVFTMHEIDRMGMTAVMEETISYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIITSAEFVEVNPILDERNKTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagaaatttcaattattggagttccaatggatttaggacaactgcgtcgcgga
gttgatatgggggcaagtgccattcgttatgcaggagtaattgaaagaattgagcacatt
ggatatgacgtgaaagatattggggatatacatattgatagagagaaagaggtagatgga
aatacaaaattaagaaaccttacacaagttgtaaaagtttgtaatgaattagcaagtaaa
gttgatcatattatagaagaagatcgttttccgcttgtactaggcggcgatcatagtata
gcgattgggacacttgcaggggtagcaaaacattataaaaatttgggtgtgatttggtat
gatgcacacggtgatctaaatacagaagaaacttcaccgtctggaaatattcatggcatg
tcgcttgctgcaagtttaggatatggacatccttcactcgtcaatttatatgaagcgtat
ccaaaggtcaaaaaggaaaacatcgtaattatcggtgcacgcgcattagatgaaggagaa
aaagaatttatccgtaatgaaggaattaaagtatttacaatgcatgaaattgatcgtatg
ggtatgacggctgttatggaagaaacgatttcttatttatcacatacagatggtgttcac
ttatctttagatttagatggtttggatccacatgatgcaccgggggttggcacacctgta
attggtggtctatcctatcgtgaaagtcatttagcaatggaaatgttagctgaagctgac
ataattacgtccgccgaatttgtggaagtaaatccaattttagatgagagaaataaaact
gcaacgacggctgttgcattaatgggttctttgttcggtgaaaaactgaaataa

DBGET integrated database retrieval system