KEGG   Bacillus cytotoxicus NVH 391-98: Bcer98_0253Help
Entry
Bcer98_0253       CDS       T00560                                 

Gene name
guaA
Definition
GMP synthase
Orthology
K01951  
GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
bcy  Bacillus cytotoxicus NVH 391-98
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bcy00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
271338..272876
Genome map
AA seq 512 aa AA seqDB search
MKKQHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNS
VYGENAFHCDEKIFELGLPIFGICYGMQLMTKHFGGKVERANHREYGKAVLKVENESKLY
TNLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSNEEKQLYGVQFHPEVRHSEHG
NDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKKVLCALSGGVDSSVVAVLIHKA
IGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKIDARERFMKKLKGVEDPEQKRKI
IGNEFIYVFDDEAAKLEGIDFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFKLI
EPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRVLGEITEEKLEIVRESDAILRE
EIQKAGLDREIWQYFTALPGMRSVGVMGDERTYDYTVGIRAVTSIDGMTADWARIPWDVL
EKISVRIVNEVKHVNRVVYDITSKPPATIEWE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaacagcacgatacgattatcgttttagactttggaagtcagtacaaccaatta
attgcacgtcgcattcgtgagttcggtgtgtacagtgagcttcatccacacacaattact
gcggaagaaattaaagcaatgaatccaaaaggtatcattttctctggtggaccaaatagt
gtatacggcgaaaatgcattccactgtgatgagaaaatttttgagctaggattacctatt
tttggtatttgttacggcatgcagctgatgacaaaacactttggtggaaaagtagagcga
gcaaaccatcgtgagtacggaaaagcagttctgaaagtagagaatgaatcaaaattatat
acaaacctgccagaagaacaagttgtatggatgagccatggtgacttagtaacaggttta
ccagaaggctttgtagtagatgcaacgagcgaatcttgtccaattgctggtatgagcaat
gaagaaaagcagttatacggtgtacaattccatccagaagtacgtcactctgagcacggt
aatgatttaattaaaaacttcgtattcggcgtatgcggttgttctgaaggctggaacatg
gagaactttattgaagtagaattagaaaaaattcgtgaaacagttggtgataaaaaagta
ctatgtgcacttagcggtggtgtagattcttctgttgtagctgtattaattcataaagca
atcggtgatcagttaacatgtatttttgttgaccacggtttacttcgtaaaggtgaagca
gaaggtgttatgaaaacatttagcgaaggcttccatatgaatgttattaaaatcgatgct
agagaacgcttcatgaaaaagctaaaaggtgtagaagatcctgaacaaaaacgtaaaatt
atcggtaacgaattcatttatgtttttgatgatgaagctgctaaattagaaggaatagac
ttcttagcgcaaggtacactgtacacagacattattgaaagtggtacagcaactgcgcaa
acaattaaatctcaccataacgtaggtggacttccagaagatatgcagttcaaattaatc
gagcctttaaatacgttatttaaagatgaagtacgtgtattaggatcagaactaggaatt
cctgatgaaattgtatggcgtcaaccattcccaggtcctggacttggtattcgtgtatta
ggtgaaattacagaagaaaaattagaaattgttcgtgaatctgatgcgattttacgtgag
gaaatccaaaaagcaggattagaccgtgaaatttggcaatacttcactgcgcttcctggt
atgcgcagcgtaggtgttatgggtgacgagcgtacttacgattatacagtaggtatccgt
gccgtaacatcaattgacggtatgacagctgactgggcacgtatcccttgggacgtatta
gagaaaatctctgtacgtatcgtaaacgaagtaaaacacgtgaaccgcgttgtatatgat
attacttctaagccaccagcaacgattgagtgggaataa

DBGET integrated database retrieval system