KEGG   Bacillus cytotoxicus: Bcer98_0253Help
Entry
Bcer98_0253       CDS       T00560                                 

Gene name
guaA
Definition
GMP synthase
Orthology
K01951  
GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
bcy  Bacillus cytotoxicus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bcer98_0253 (guaA)
Enzymes [BR:bcy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     Bcer98_0253 (guaA)
Peptidases [BR:bcy01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   Bcer98_0253 (guaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
271338..272876
Genome map
AA seq 512 aa AA seqDB search
MKKQHDTIIVLDFGSQYNQLIARRIREFGVYSELHPHTITAEEIKAMNPKGIIFSGGPNS
VYGENAFHCDEKIFELGLPIFGICYGMQLMTKHFGGKVERANHREYGKAVLKVENESKLY
TNLPEEQVVWMSHGDLVTGLPEGFVVDATSESCPIAGMSNEEKQLYGVQFHPEVRHSEHG
NDLIKNFVFGVCGCSEGWNMENFIEVELEKIRETVGDKKVLCALSGGVDSSVVAVLIHKA
IGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFHMNVIKIDARERFMKKLKGVEDPEQKRKI
IGNEFIYVFDDEAAKLEGIDFLAQGTLYTDIIESGTATAQTIKSHHNVGGLPEDMQFKLI
EPLNTLFKDEVRVLGSELGIPDEIVWRQPFPGPGLGIRVLGEITEEKLEIVRESDAILRE
EIQKAGLDREIWQYFTALPGMRSVGVMGDERTYDYTVGIRAVTSIDGMTADWARIPWDVL
EKISVRIVNEVKHVNRVVYDITSKPPATIEWE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaacagcacgatacgattatcgttttagactttggaagtcagtacaaccaatta
attgcacgtcgcattcgtgagttcggtgtgtacagtgagcttcatccacacacaattact
gcggaagaaattaaagcaatgaatccaaaaggtatcattttctctggtggaccaaatagt
gtatacggcgaaaatgcattccactgtgatgagaaaatttttgagctaggattacctatt
tttggtatttgttacggcatgcagctgatgacaaaacactttggtggaaaagtagagcga
gcaaaccatcgtgagtacggaaaagcagttctgaaagtagagaatgaatcaaaattatat
acaaacctgccagaagaacaagttgtatggatgagccatggtgacttagtaacaggttta
ccagaaggctttgtagtagatgcaacgagcgaatcttgtccaattgctggtatgagcaat
gaagaaaagcagttatacggtgtacaattccatccagaagtacgtcactctgagcacggt
aatgatttaattaaaaacttcgtattcggcgtatgcggttgttctgaaggctggaacatg
gagaactttattgaagtagaattagaaaaaattcgtgaaacagttggtgataaaaaagta
ctatgtgcacttagcggtggtgtagattcttctgttgtagctgtattaattcataaagca
atcggtgatcagttaacatgtatttttgttgaccacggtttacttcgtaaaggtgaagca
gaaggtgttatgaaaacatttagcgaaggcttccatatgaatgttattaaaatcgatgct
agagaacgcttcatgaaaaagctaaaaggtgtagaagatcctgaacaaaaacgtaaaatt
atcggtaacgaattcatttatgtttttgatgatgaagctgctaaattagaaggaatagac
ttcttagcgcaaggtacactgtacacagacattattgaaagtggtacagcaactgcgcaa
acaattaaatctcaccataacgtaggtggacttccagaagatatgcagttcaaattaatc
gagcctttaaatacgttatttaaagatgaagtacgtgtattaggatcagaactaggaatt
cctgatgaaattgtatggcgtcaaccattcccaggtcctggacttggtattcgtgtatta
ggtgaaattacagaagaaaaattagaaattgttcgtgaatctgatgcgattttacgtgag
gaaatccaaaaagcaggattagaccgtgaaatttggcaatacttcactgcgcttcctggt
atgcgcagcgtaggtgttatgggtgacgagcgtacttacgattatacagtaggtatccgt
gccgtaacatcaattgacggtatgacagctgactgggcacgtatcccttgggacgtatta
gagaaaatctctgtacgtatcgtaaacgaagtaaaacacgtgaaccgcgttgtatatgat
attacttctaagccaccagcaacgattgagtgggaataa

DBGET integrated database retrieval system