KEGG   Bacillus cytotoxicus: Bcer98_0560Help
Entry
Bcer98_0560       CDS       T00560                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bcer98_0560
Enzymes [BR:bcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bcer98_0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin ADH_zinc_N Guanylin
Motif
Other DBs
NCBI-ProteinID: ABS20909
JGI: Bcer980560
UniProt: A7GLA1
Position
640432..641328
Genome map
AA seq 298 aa AA seqDB search
MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTVPGGKGANQAVAAARLGANVAMVGA
VGNDDYGMSVRKNLENERVFIDHVVPVTDETTGIAHIVLAEEDNSIVVVQGANRLVNQQI
VDRAKDLLVKADMVVLQLEIPLETVEYVLTICEEHKIPVMLNPAPAQALSTRILEKATYI
TPNEHECRIVLDDFESPIEDLLAKYPNKLLMTEGSKGVRFHNGTEIVQVPSISVKVVDTT
GAGDTFNGALAVSLAEGEVLEKAIRFANIAGGLSVTKLGAQGGMPTREQVREVQGIVK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgccaaatatagctgtagtagggagtatttcaatggatttagtagccgtttcaaagaaa
agaccgaaagctggagaaacagtaatcggagaggcgtttcatacagtacctggaggaaaa
ggagcaaatcaggctgttgccgcagctcgcttaggggccaatgtagctatggtaggtgct
gtagggaatgatgattacggcatgagtgtacgaaaaaatttagagaacgagcgtgttttt
atcgatcatgtggtaccggttacagatgaaacaacaggcattgctcatatcgttttagca
gaagaagataatagcattgttgttgtgcaaggtgccaatcgccttgtgaatcagcaaatt
gttgaccgtgcaaaagatttacttgtaaaggcagatatggtcgttcttcagttagaaatt
ccgcttgagacagtagaatatgtgcttactatttgtgaggagcataagatcccagtcatg
ttaaatccagctccagcacaagcattatcgacaaggattttggaaaaggcaacatatatt
acaccgaatgaacacgagtgtcgcattgtactagatgattttgaatcaccgattgaagac
ttacttgctaaatatccaaataaattattaatgacagaaggaagtaaaggagttcgattc
cataatggtacagaaattgtacaagtgccaagtatttctgtaaaagtagttgacacgaca
ggggctggtgatacatttaacggggcattagcagtttcgcttgcagaaggagaagtgctt
gaaaaagcaattcgttttgcaaatatagccggtggcctttctgtaacaaagctcggtgca
caaggtggtatgccaacaagagaacaggtgcgggaagtacaggggattgttaaatga

DBGET integrated database retrieval system