KEGG   Bacillus cytotoxicus: Bcer98_0560Help
Entry
Bcer98_0560       CDS       T00560                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bcy  Bacillus cytotoxicus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bcer98_0560
Enzymes [BR:bcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bcer98_0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
640432..641328
Genome map
AA seq 298 aa AA seqDB search
MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTVPGGKGANQAVAAARLGANVAMVGA
VGNDDYGMSVRKNLENERVFIDHVVPVTDETTGIAHIVLAEEDNSIVVVQGANRLVNQQI
VDRAKDLLVKADMVVLQLEIPLETVEYVLTICEEHKIPVMLNPAPAQALSTRILEKATYI
TPNEHECRIVLDDFESPIEDLLAKYPNKLLMTEGSKGVRFHNGTEIVQVPSISVKVVDTT
GAGDTFNGALAVSLAEGEVLEKAIRFANIAGGLSVTKLGAQGGMPTREQVREVQGIVK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgccaaatatagctgtagtagggagtatttcaatggatttagtagccgtttcaaagaaa
agaccgaaagctggagaaacagtaatcggagaggcgtttcatacagtacctggaggaaaa
ggagcaaatcaggctgttgccgcagctcgcttaggggccaatgtagctatggtaggtgct
gtagggaatgatgattacggcatgagtgtacgaaaaaatttagagaacgagcgtgttttt
atcgatcatgtggtaccggttacagatgaaacaacaggcattgctcatatcgttttagca
gaagaagataatagcattgttgttgtgcaaggtgccaatcgccttgtgaatcagcaaatt
gttgaccgtgcaaaagatttacttgtaaaggcagatatggtcgttcttcagttagaaatt
ccgcttgagacagtagaatatgtgcttactatttgtgaggagcataagatcccagtcatg
ttaaatccagctccagcacaagcattatcgacaaggattttggaaaaggcaacatatatt
acaccgaatgaacacgagtgtcgcattgtactagatgattttgaatcaccgattgaagac
ttacttgctaaatatccaaataaattattaatgacagaaggaagtaaaggagttcgattc
cataatggtacagaaattgtacaagtgccaagtatttctgtaaaagtagttgacacgaca
ggggctggtgatacatttaacggggcattagcagtttcgcttgcagaaggagaagtgctt
gaaaaagcaattcgttttgcaaatatagccggtggcctttctgtaacaaagctcggtgca
caaggtggtatgccaacaagagaacaggtgcgggaagtacaggggattgttaaatga

DBGET integrated database retrieval system