KEGG   Bacillus cytotoxicus: Bcer98_0768Help
Entry
Bcer98_0768       CDS       T00560                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bcy  Bacillus cytotoxicus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bcer98_0768
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcer98_0768
  Lipid metabolism
   00071 Fatty acid degradation
    Bcer98_0768
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcer98_0768
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcer98_0768
   00626 Naphthalene degradation
    Bcer98_0768
Enzymes [BR:bcy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcer98_0768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
881687..882712
Genome map
AA seq 341 aa AA seqDB search
MKAVVVNKNSKANIEVIEKELRPLRAGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGIGIVTKIADDVTSLQVGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYTVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSDIKPGQSIVIYGCGGLGNLAV
QYAKHVFGAKVIAVDINDDKLALAKKVGADMTINPTTQGLADKIIQEAFGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTCSLDEVQDVFEEMEQGKIQGRMVIDFKQHK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtggttaataaaaacagcaaagcaaacattgaagttatcgaaaaagaa
ttacgtccgttacgcgcaggcgaagcgttagtagatgtagaatattgcggagtttgtcat
actgacttacacgttgcaaatcatgactttggtaacacagatggtcgtattcttggacac
gagggcataggaattgtaacgaaaattgcagatgatgttacttcgcttcaggttggtgac
cgtgtaagtatcgcatggatgttccaatcttgtggtcgttgtgaatattgcgtaactggt
agagaaacattttgtcgtgaagttaagaatgcgggttatacagtagatggcggtatggct
gaacaatgtatcgttactgctgattatgcggtaaaagtaccagaaggattagatcctgct
caagcatcatctatcacatgtgccggtgtaactacatataaagcgattaaagtatccgat
attaaacctggccaatctatcgtaatctacggttgtggtggattaggtaaccttgctgtc
caatatgcgaaacatgtatttggtgcaaaggttattgcagtagatatcaatgacgacaaa
ttagcattggctaaaaaggttggtgctgatatgacaatcaatccaactactcaaggactt
gctgataagataattcaagaggcatttggtggtgcttatgctgctgtagtaacagcagtt
tctaaagtggccttcaactcagcagttgatgcagtccgtgcttgcggtaaagtcgttgcg
gtaggtttaccagtagaaactatggatttaagcattccacgacttgtgttagatggaatt
gaagtagtaggttctttagttggtactcgtaaggacttagaagaagcatttatgttcggt
gcagaaggcaaagtagtgccggttgttcaaacttgttcattagatgaagtacaagatgta
ttcgaagaaatggagcaaggtaagattcaaggtcgtatggtaatcgattttaaacagcat
aagtaa

DBGET integrated database retrieval system