KEGG   Bacillus cytotoxicus NVH 391-98: Bcer98_0785Help
Entry
Bcer98_0785       CDS       T00560                                 

Definition
glycoside hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bcy  Bacillus cytotoxicus NVH 391-98
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bcy00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
898387..899826
Genome map
AA seq 479 aa AA seqDB search
MAKVTFPKGFLWGGAMAANQAEGAYLEDGKGLTTVDLLPTGEKRWDIMKGNIQSFTPMEG
EFYPSHEAIDFYHRYKEDIALFAEMGFKALRVSIAWTRIFPNGDEKQPNETGLQFYDNLF
DELLKYGIEPVVTMAHFDVPVHLVETYGSWRNRKLIHFFETYAKTIFKRYKDKVKYWMTF
NEINMLLHLPFVGAGLTFKEGENKKQIQYQAAHHQLVASALAVKACHEIIPDAKIGCMLA
AGATYPYTCNPDDVLRAMEQDRESFFFIDVQARGEYPGYAKRFFKDNHLEIEMEKEDEEI
LKAYTVDYIGFSYYASRAASTDPEVLKGITSGNVFGSVENPYLEKSEWGWTIDPKGFRIT
ANQLYDRYQKPLFVVENGLGAIDTLHAEEEINDEYRIDYLRKHMIELSEAIQDGVEVIGY
TSWGPIDLVSASTGEMKKRYGYIYVDKDNEGKGSLKRFKKKSFDWYKQVIATNGESLNA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagttacgtttccaaaaggttttttatggggtggggcaatggctgctaaccaa
gctgaaggagcatatttagaagatggaaaaggattaacaacagtggatctccttccaact
ggtgaaaaacgttgggatattatgaaaggaaatatccaatcctttacaccgatggaagga
gaattttatccatcgcatgaagcaattgatttttaccatcgttataaagaagatattgct
ctgtttgcagaaatgggatttaaagcgttacgcgtttcgattgcgtggacacgtattttt
ccaaatggtgacgagaaacagccaaatgaaacaggtttgcagttttatgataatttgttt
gacgaattattgaaatatggaattgagccggtcgtgacaatggctcattttgatgtacct
gttcatttagtcgaaacatatggaagctggagaaatcgaaagcttatccatttctttgaa
acatatgcaaaaacgatttttaaacgatataaagataaagtgaaatattggatgacgttt
aatgaaattaatatgctactgcatttacctttcgttggtgctggtttaacttttaaagaa
ggcgaaaataaaaaacaaattcaatatcaagcagcacatcatcagcttgtggcaagtgct
ttagcagtgaaagcgtgccatgaaataataccggatgctaaaattggttgtatgcttgca
gcaggagcgacgtatccatatacatgcaatccagatgatgttttacgagcgatggaacaa
gatagagaatcattctttttcattgatgtacaagcaagaggtgaatatcctggatatgcg
aagcgattctttaaagataatcacttagagattgaaatggaaaaagaagatgaagagatt
ttaaaagcatatacagtggattatattggatttagctactatgctagccgagcagcaagt
acagaccctgaagtattaaagggcattacaagtggaaatgtatttggctctgttgaaaat
ccgtatcttgaaaaatcagaatggggctggacaattgatccaaaagggttccgtattaca
gcaaatcaactgtacgatcgttatcagaaaccgctgtttgttgtggaaaatggtctaggt
gcaattgacacattacatgctgaagaagagattaacgatgagtatcgcatcgattattta
cgaaaacatatgattgaactttcagaggcaatccaagatggggtagaggttattggatat
acaagctggggcccaattgaccttgtcagcgcttcaacaggtgagatgaagaaacggtat
ggatatatttatgttgataaagataatgaaggaaaaggatcattaaaaagattcaaaaag
aaaagttttgattggtataaacaagtcattgcaacaaacggtgaaagtttaaacgcttaa

DBGET integrated database retrieval system