KEGG   Bacillus cytotoxicus: Bcer98_0807Help
Entry
Bcer98_0807       CDS       T00560                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bcy  Bacillus cytotoxicus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Bcer98_0807 (glpK)
Enzymes [BR:bcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Bcer98_0807 (glpK)
Exosome [BR:bcy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcer98_0807 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
922678..924168
Genome map
AA seq 496 aa AA seqDB search
METYILSLDQGTTSSRAILFNKKGEIVHSAQKEFTQYFPKPGWVEHNAQEIWGSILAVIA
TCLSEADVKPEQIAGIGITNQRETAVVWEKATGKPVYNAIVWQSRQTAEICEELKEKGYG
DMVREKTGLLIDAYFSGTKVKWILDNVEGAREKAERGELLFGTIDTWLVWKLSGGKAHVT
DYSNASRTLMFNIHDLKWDDELLEILTVPKSMLPEVRPSSEVYGHTVDYHFFSQNVPIAG
VAGDQQAALFGQACFSEGMAKNTYGTGCFMLMNTGETAVNSNHGLLTTIAWGLNGKVNYA
LEGSIFVAGSAIQWLRDGMRMVNDASESEEYASRVESTDGVYVVPAFVGLGTPYWDSEVR
GAVFGVTRGTTKEHFIRATLESLGYQTRDVLCAMEADSGIELKTLRVDGGAVKNNFLMQF
QSDMLQVPVERPMISETTALGAAYLAGLAVGYWESQEEIKAQWDMDRSFTPEMEKERSEE
LYSGWKKAIEATKAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaaacatatattctttcattagatcaaggtacaacaagttcacgtgccattctgttt
aataaaaaaggagaaattgttcattctgctcaaaaagaatttacacaatattttccaaag
ccaggttgggtagaacataatgcacaagagatttgggggtccattctagcggttatcgca
acttgcttaagtgaagcggatgtgaagccagaacaaatcgctggtattgggattacaaac
caacgtgaaacagcagttgtttgggagaaagcaaccgggaaaccagtttataatgcaatt
gtatggcaatctcgtcaaacagctgaaatttgtgaagagttaaaagaaaaaggctatggc
gatatggttcgcgaaaaaacaggtcttttaattgatgcatatttctcaggtacgaaagta
aagtggattttagataacgttgaaggtgcaagagaaaaagcagagcgcggtgaattatta
ttcggtacaattgatacatggcttgtatggaaattgtctggtggtaaagcacacgtaaca
gattattcaaatgcatcacgcacattaatgttcaatattcatgacttaaaatgggatgat
gaattattagaaatactaacagtaccaaagagcatgttaccagaagtacgtccatcatct
gaagtatacggtcatacagttgattatcatttcttctctcaaaatgtaccgattgctggt
gtggcaggtgaccaacaagcagcgttatttgggcaagcgtgcttcagtgaagggatggcg
aaaaacacatacggaacaggttgcttcatgttaatgaatacaggtgaaacagcagttaac
tctaatcacggtctattaacaacaattgcgtgggggttaaatggtaaagtaaattatgca
ttagaaggaagtattttcgtagctggttcagcaatccagtggttacgagatggcatgcgt
atggttaatgatgcaagtgagagtgaggagtatgcatcacgcgtggaatcaacggacggt
gtatacgttgtaccagcatttgtaggacttggaacgccgtattgggacagtgaagtacgc
ggagctgtgtttggtgtaacgcgcggtacaacgaaagagcacttcattcgtgcaacatta
gaatcattaggatatcaaacaagagatgtattatgtgcaatggaagcagattctggcatt
gagttgaaaacgttacgcgttgatggcggtgcagtgaaaaataacttcttaatgcagttc
caaagcgatatgttacaggttcctgtagagcgtccaatgattagtgaaacgacagcttta
ggggctgcatatttagcaggtctagctgttggatattgggaaagtcaagaagaaattaaa
gcgcagtgggatatggatcgaagctttacaccagaaatggagaaagaaagaagcgaagag
ctctattctggatggaaaaaagcaattgaagcaacaaaagcttttaaataa

DBGET integrated database retrieval system