KEGG   Bacillus cytotoxicus: Bcer98_0826Help
Entry
Bcer98_0826       CDS       T00560                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00860  Porphyrin and chlorophyll metabolism
bcy01100  Metabolic pathways
bcy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bcer98_0826
Enzymes [BR:bcy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Bcer98_0826
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Bcer98_0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 NAD_binding_9 HI0933_like MCRA Pyr_redox_3 Thi4 Lycopene_cycl Trp_halogenase FAD_binding_2 GIDA DUF4988 Pyr_redox AlaDh_PNT_C FAD_binding_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ABS21162
JGI: Bcer980826
UniProt: A7GM04
Position
941243..942664
Genome map
AA seq 473 aa AA seqDB search
MKKRVVIIGGGIAGLTAAYYLQKEIREQGLQIDMLLIEASGKVGGKIQTVRKEGFTIERG
PDSFLERKESAARLVKEVGLGDELVNNKAGQSFVLVNNQLHKIPSGSMMGIPTQITPFLF
SGLFSPIGKLRASFDFVLPRSKPVSDQSLGQFFRRRFGNEVVENLIEPLLAGIYAGDIDQ
MSLMATFPKVYQIEQKYRSISLGMRALAPKRTKDVKPKGMFLTLKTGLESLVEAIEEKLD
TNTVMKGTRVEKVKKLGDGYEITLSNGKEIEADAVIIAAPHKGLPSMFGQYKEFRFFRNI
PATSVANVALAFPKEAIKRDIDGTGFVVSRNSDFSITACTWAHKKWPHTTPEGKVLLRCY
VGRPGDEAIVEQTDEEIIQFVLEDLQKTMDIVERPDFTVVSRWKDAMPQYTVGHKKRMKK
LTAFLKQELPGIYLAGSSYAGSGLPDCIDQGEAAVKYVLSYLEERNKTKLIAQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaagagtggttatcattggtggtggaattgcgggattgacagcagcgtattac
ttgcaaaaagaaattcgtgaacaagggttgcagattgatatgttgttaatagaagcgtca
ggtaaggttggcgggaaaattcaaaccgttcgaaaagaaggatttacaattgaacgcggc
ccagattctttcctcgaaagaaaagaaagtgcagctcgattggtgaaagaagtcggttta
ggagacgagcttgtaaataataaagcaggtcagtcatttgttcttgtgaacaatcaattg
cacaaaattccgagcggatctatgatgggaattccgacacaaattacgccgtttctattt
tcaggattgttttctccgattggtaaattaagggctagttttgattttgtacttccgcgt
tcaaaaccagtttcggatcaatcactaggccaattttttcggcgtcgtttcggaaatgaa
gtggttgaaaatttaattgaaccattgctcgctggtatttatgcaggggatattgatcaa
atgagtttgatggcaacattcccaaaagtttatcaaatagagcagaagtaccgcagtatt
tcgcttggtatgcgtgcgttagcaccaaaacgaacaaaagatgtgaaaccaaaagggatg
tttctaacattaaaaacaggcttagagtcgttagttgaggcaatagaagaaaaacttgat
acgaatacagtgatgaagggaacgcgcgttgaaaaagtgaaaaagctgggcgatggctat
gaaatcactcttagcaacggaaaagaaatagaggcagatgcagttatcattgcagctccg
cataaaggattgccatctatgttcgggcagtataaagagttccgcttcttccgcaatatt
ccggcaacctctgtagcgaatgtcgcactagcttttccgaaagaagccattaagcgcgat
attgatggaactggatttgtcgtatcaagaaatagtgatttttccattacagcttgcacg
tgggcacataaaaagtggccacatacaacgccggaagggaaagtattgttgcgctgctat
gtagggcgtcctggcgatgaagccattgtagaacaaacagatgaagaaataattcaattt
gtattagaagatttacaaaaaacaatggatatagtagagaggccagactttactgtcgtg
agccgctggaaagatgctatgccgcaatatacagttggacataaaaaaagaatgaaaaaa
ctaacagcatttctaaaacaagaactaccaggcatatatttagctggtagctcctatgct
ggctctggtcttccagattgcattgatcaaggtgaggcggctgtaaaatatgtattatct
tatttagaagaacgcaataaaacaaaattaatcgcgcaataa

DBGET integrated database retrieval system