KEGG   Bacillus cytotoxicus: Bcer98_0853Help
Entry
Bcer98_0853       CDS       T00560                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bcy  Bacillus cytotoxicus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcer98_0853
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcer98_0853
   00630 Glyoxylate and dicarboxylate metabolism
    Bcer98_0853
Enzymes [BR:bcy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bcer98_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
969280..970869
Genome map
AA seq 529 aa AA seqDB search
MSTQTSRVTLAGELLPSYNEILTPEALTFLKELHENFNERRIQLLKKREEKQKRIDAGEF
PNFLPETAHIRAGNWTIAPLPRDLEDRRVEITGPVDRKMIINALNSGAHLFMADFEDSSS
PTWKNIIEGQINLRDAAKGTISYKSPSGKEYRLGDQTAVLIVRPRGWHLEEKHMQVDGKR
MSGSLVDFGLYFFHNAKTLIEKGSGPYFYLPKMESYLEARLWNDVFVFAQKYVGIPNGTI
KATVLLETIHAAFEMDEILYELRDHSAGLNCGRWDYIFSFLKCFRNHKAFLLPDRAQVTM
TVPFMRAYSLKVIQTCHRRNAPAMGGMAAQIPIKNNPEANEIAFEKVRVDKEREALDGHD
GTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREELHVTEKDLLEVPMGTITEEGLRMNISV
GIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEEGKLNDGRKVTFALVEQLK
AEELAKIEKEIGKESFEKGRFVEATKLFTDLVRKDEFEPFLTLPGYEIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgcaaacttcacgagtgacactcgctggagaattattaccatcgtacaacgaa
attttgacaccagaagcgcttacttttttgaaagagttgcatgagaatttcaatgaacgt
cgtattcagttattaaagaaacgagaagaaaaacagaaaagaattgatgcgggagagttt
ccgaattttttaccagaaacagcacatatacgtgcgggcaattggacaattgcgccgctt
ccgcgtgatttagaagatcgacgcgtagagattacgggacccgtagatcgaaagatgatt
attaatgctttaaactctggggcacatctttttatggcagattttgaagactcgagttca
ccaacatggaaaaacataatagaaggtcaaataaacttaagagatgctgcgaaaggaacg
atttcatataagagcccaagtgggaaagaataccgtcttggcgatcaaacagctgtactt
attgtacgtccgcgcggttggcatttagaagaaaagcatatgcaagttgacgggaaacgt
atgtcaggaagtcttgtagactttggactgtactttttccataatgcgaaaactttaatt
gaaaaaggaagcggtccatatttttacttgccaaagatggagagctatttagaggctcgt
ttatggaatgatgtatttgtatttgcacagaagtatgtcggtattccaaatggcacaatt
aaagcgacggtactgcttgagacgatccatgctgcatttgaaatggatgaaattttatat
gaattacgtgatcactccgctggattaaattgtggacgatgggattatatctttagcttt
ttaaaatgtttccgcaatcataaagcatttttgcttccagacagagcacaagttacgatg
acagtaccgtttatgcgcgcgtattctttgaaagtcattcaaacgtgtcaccgccgaaat
gcaccagcgatgggggggatggcagcgcaaattccaattaaaaataatccagaggcgaat
gaaatcgcctttgaaaaagtgcgggtcgataaagagcgcgaagctttagatgggcatgat
ggaacttgggttgctcatccagggctcgtaccagttgcgatggaagtatttaatcacatt
atgaaaacaccaaatcaaatatttagaaaacgggaggaactgcatgtaacagaaaaagat
ttattagaagtacctatgggaacgattacagaagaagggctgcgcatgaatatcagtgtt
ggcattcaatatattgcgtcatggctaagtggacgcggggcagcacctatttataactta
atggaagatgcggcaacagcggaaatatcaagagcgcaagtttggcagtggattcgtcat
gaggaggggaaactgaatgacggtcgtaaagttacgtttgctttagtagaacaattgaag
gcggaagaactagcgaaaatagagaaggagattggaaaagaatcatttgagaaaggtaga
tttgtagaagcgacaaagttatttactgatttagtgcgtaaggatgagtttgaaccattt
ttaacattacctggttatgaaattttataa

DBGET integrated database retrieval system