KEGG   Bacillus cytotoxicus: Bcer98_0960Help
Entry
Bcer98_0960       CDS       T00560                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00020  Citrate cycle (TCA cycle)
bcy00310  Lysine degradation
bcy01100  Metabolic pathways
bcy01110  Biosynthesis of secondary metabolites
bcy01120  Microbial metabolism in diverse environments
bcy01130  Biosynthesis of antibiotics
bcy01200  Carbon metabolism
Module
bcy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcer98_0960
  Amino acid metabolism
   00310 Lysine degradation
    Bcer98_0960
Enzymes [BR:bcy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bcer98_0960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Orai-1
Motif
Other DBs
NCBI-ProteinID: ABS21291
JGI: Bcer980960
UniProt: A7GMD3
Position
complement(1078508..1079752)
Genome map
AA seq 414 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEIGDVIAILDENGTAAASTPAAPEQPKEEAPKAEAPSAAPSQTALQGLPNTDRP
IASPAARKMARELGIDLNEVRSTDPLGRIRPHDVQAHAAAPKAEPKQEKTSPKPAVTTEF
DKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAIMELRKERKEAFEKKHDVRL
GFMSFFTKAVVAALKQFPLLNAEIQGDELVVKKFYDIGIAVAAPDGLVVPVVRDADKLNF
AEIERNIRDLGKKARDNKLTLKELQGGTFTITNGGVFGSLMSTPILNAPQVGILGMHKIQ
VRPVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKEMLEDPKSLLLEG
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaattaaagtacctgagcttgcagaatctattacagaaggaactatttcgcaa
tggctgatcaacgtaggcgacaaagttgaaaaaggtggtagcgttgttgagctagaaact
gataaagtcaatgttgaaatcattgcagaagattcaggtattgtatcaaaactattagga
gaacctggagatacagttgaaattggcgacgtcattgcaattttagatgaaaatggtaca
gctgcagcaagtacaccagctgctccagaacaaccaaaagaagaagctccaaaagctgag
gctccaagcgctgcgccaagtcaaacagcattacaaggtcttccaaatacagaccgccct
atcgcatcacctgctgctcgaaaaatggcacgtgaattaggcatcgatttaaatgaagtg
cgcagtactgatccacttggccgcataagaccacatgatgtacaagcacatgctgcagct
ccaaaagcagaaccaaaacaagaaaaaacaagtccaaaaccagctgtaacaactgaattt
gacaaaccagttgagcgcgtaaaaatgtcccgccgccgtcaaacaattgcaaaacgactt
gtcgaagttcaacaaacatctgctatgttaacaacatttaacgaagttgatatgactgcg
attatggaattacgtaaagaacgcaaagaagcatttgagaaaaaacatgatgttcgtctt
ggctttatgtcattctttacaaaagcagttgttgcagcattaaaacagttcccactatta
aatgctgaaattcaaggcgacgagcttgttgttaaaaaattctatgacatcggtatcgct
gtagctgctccagatggattagttgttccagttgtacgcgatgcagataaattaaacttt
gctgaaattgaaagaaatattcgtgacctaggtaaaaaagctcgtgacaataaacttaca
ttaaaagaactacaaggtggcacattcacaattacaaacggcggtgtattcggttccctt
atgtcaacaccaattttgaatgctccacaagtcggtattcttggaatgcacaaaattcaa
gtaagaccagttgcaattgataacgagcgtatggaaaaccgtccaatgatgtacattgct
ttatcttatgaccatcgtattgtcgacggtaaagaagctgttagcttccttgtagcagta
aaagaaatgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system