KEGG   Bacillus cytotoxicus: Bcer98_0960Help
Entry
Bcer98_0960       CDS       T00560                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcy  Bacillus cytotoxicus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcer98_0960
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcer98_0960
  Amino acid metabolism
   00310 Lysine degradation
    Bcer98_0960
Enzymes [BR:bcy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bcer98_0960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1078508..1079752)
Genome map
AA seq 414 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEIGDVIAILDENGTAAASTPAAPEQPKEEAPKAEAPSAAPSQTALQGLPNTDRP
IASPAARKMARELGIDLNEVRSTDPLGRIRPHDVQAHAAAPKAEPKQEKTSPKPAVTTEF
DKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAIMELRKERKEAFEKKHDVRL
GFMSFFTKAVVAALKQFPLLNAEIQGDELVVKKFYDIGIAVAAPDGLVVPVVRDADKLNF
AEIERNIRDLGKKARDNKLTLKELQGGTFTITNGGVFGSLMSTPILNAPQVGILGMHKIQ
VRPVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKEMLEDPKSLLLEG
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaattaaagtacctgagcttgcagaatctattacagaaggaactatttcgcaa
tggctgatcaacgtaggcgacaaagttgaaaaaggtggtagcgttgttgagctagaaact
gataaagtcaatgttgaaatcattgcagaagattcaggtattgtatcaaaactattagga
gaacctggagatacagttgaaattggcgacgtcattgcaattttagatgaaaatggtaca
gctgcagcaagtacaccagctgctccagaacaaccaaaagaagaagctccaaaagctgag
gctccaagcgctgcgccaagtcaaacagcattacaaggtcttccaaatacagaccgccct
atcgcatcacctgctgctcgaaaaatggcacgtgaattaggcatcgatttaaatgaagtg
cgcagtactgatccacttggccgcataagaccacatgatgtacaagcacatgctgcagct
ccaaaagcagaaccaaaacaagaaaaaacaagtccaaaaccagctgtaacaactgaattt
gacaaaccagttgagcgcgtaaaaatgtcccgccgccgtcaaacaattgcaaaacgactt
gtcgaagttcaacaaacatctgctatgttaacaacatttaacgaagttgatatgactgcg
attatggaattacgtaaagaacgcaaagaagcatttgagaaaaaacatgatgttcgtctt
ggctttatgtcattctttacaaaagcagttgttgcagcattaaaacagttcccactatta
aatgctgaaattcaaggcgacgagcttgttgttaaaaaattctatgacatcggtatcgct
gtagctgctccagatggattagttgttccagttgtacgcgatgcagataaattaaacttt
gctgaaattgaaagaaatattcgtgacctaggtaaaaaagctcgtgacaataaacttaca
ttaaaagaactacaaggtggcacattcacaattacaaacggcggtgtattcggttccctt
atgtcaacaccaattttgaatgctccacaagtcggtattcttggaatgcacaaaattcaa
gtaagaccagttgcaattgataacgagcgtatggaaaaccgtccaatgatgtacattgct
ttatcttatgaccatcgtattgtcgacggtaaagaagctgttagcttccttgtagcagta
aaagaaatgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system