KEGG   Bacillus cytotoxicus: Bcer98_1497Help
Entry
Bcer98_1497       CDS       T00560                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bcy  Bacillus cytotoxicus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcer98_1497
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcer98_1497
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bcer98_1497
Enzymes [BR:bcy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bcer98_1497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1605750..1606808
Genome map
AA seq 352 aa AA seqDB search
MYKGLLKQYASYLPVSHNTPEVSLMEGNTPLIPLENISEKLGICLYGKYEGANPTGSFKD
RGMVMAVAKAKEMGSKAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAFA
YGAEIISIEGNFDDALRAVRQIAAEESITLVNSVNPYRIEGQKTAAFEICDQLQKAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEGPETIATAIRI
GNPASWHYAVEAAEQSNGEIDMVSDEEIVKAYQLLARTEGVFAEPGSNASLAGIIKHVQL
GKIRQGETVVAVLTGNGLKDPDIAISSNSLQITNISNDLEQMKGHIKGVIIS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagggttattaaaacaatatgcttcttatttacctgtgagccacaatacacca
gaggttagtttgatggagggaaatacaccgcttattccgcttgaaaatatctctgaaaaa
ttagggatatgtttatacggaaaatatgaaggagcaaatccaaccggttcgtttaaagat
cgcggtatggtaatggcagttgcaaaagcaaaagagatgggttcaaaagccattatttgt
gcttcgacagggaatacttcggcatctgcagcagcatatgcggctcgccttggaatgaaa
tgtattatcgttataccggaaggtaaaattgctcatggaaagttagcacaggcgtttgca
tatggtgcagaaattatttcgatagaaggaaattttgatgatgcgctgcgagcagtgcga
caaatcgcggccgaagagtctattacattagtaaactctgttaatccgtatcggattgaa
gggcagaaaacagctgcgtttgaaatttgtgatcagttgcaaaaagcgccagatgttctt
gctattccagttggaaatgctgggaatattactgcatattggaaaggtttttgtgaatac
gagaaagagaaagggtataaaaaaccaagaatccatgggtttgaagcggaaggtgcagca
gcgattgtaaaaggtcatgtcattgaaggaccagaaacaattgcaactgcaattcgaatt
ggcaatcctgcaagctggcattatgcagtggaggctgctgaacagtcgaacggtgaaatt
gatatggtatcggatgaagagattgtaaaggcttatcaattgctagcgagaacagaagga
gtgtttgctgaaccaggttccaacgcttctttagcggggatcattaaacatgttcaatta
ggtaaaattcgtcaaggagagacagtcgtcgctgtattaacaggaaatggtttgaaagat
ccggatatcgcaatctcctcgaattcattacaaattacaaatatctcaaatgatttagaa
caaatgaaaggtcatattaagggagtgattatttcgtga

DBGET integrated database retrieval system