KEGG   Bacillus cytotoxicus: Bcer98_1604Help
Entry
Bcer98_1604       CDS       T00560                                 

Definition
(GenBank) protein tyrosine phosphatase
  KO
K03741  
arsenate reductase [EC:1.20.4.1]
Organism
bcy  Bacillus cytotoxicus
Brite
Enzymes [BR:bcy01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.1  arsenate reductase (glutaredoxin)
     Bcer98_1604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1709026..1709430
Genome map
AA seq 134 aa AA seqDB search
MENKKIIYFLCTGNSCRSQMAEAWGKEYLGDKWNVLSAGIEAHGVNPNAVKAMKEVDIDI
TDQTSDIIDRDILDKADLVVTLCGHANDVCPTTPPHVKRVHWGFDDPAGQEWSVFQRVRD
EIGARIKKFAETGE
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaagaaaataatttactttttatgcacaggaaattcttgtcgtagccaaatg
gcagaagcttggggcaaagaatatttaggtgacaaatggaatgtactttctgctggtatt
gaggcgcatggagtaaatccgaatgcggttaaagcaatgaaagaagtagatattgatatt
acggatcaaacatcagatatcattgatcgtgacattttagataaagcggatcttgttgta
acactttgtggtcatgcaaatgatgtgtgtccaaccacaccgcctcatgtaaaacgagtt
cactggggatttgatgatccagctggtcaagaatggtctgtattccaaagagttcgtgat
gaaattggcgcacgcattaaaaaattcgctgaaacaggagaataa

DBGET integrated database retrieval system