KEGG   Bacillus cytotoxicus NVH 391-98: Bcer98_1774Help
Entry
Bcer98_1774       CDS       T00560                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bcy  Bacillus cytotoxicus NVH 391-98
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bcy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1889482..1890882
Genome map
AA seq 466 aa AA seqDB search
MKTVLVIGGGITGLSTMFYLERMKKDYNLDLNLILVEKEKYLGGKIHSVKKHGFIMETGA
DSMVARNEHVIPLIKELNLEEEMVYNETGISYIYSDNMLHPIPADTVFGIPTSVESLFHS
TLVSAKGKITALKDFITKNKSFTKETSLALFLESFLGKELVEKQIAPVLSGVYSGKLHEL
TMASTLPYLVDYKNKYGSIIKGFEVNKKQFQAAGNKKFVSFKNGLSTIIHRLEETLSDTE
IRKGMLTTNISKNDDGYEVSFVNGETVKADCVVLAVPHDVAQTILHSRDLDDEFDKFKNS
SLVSIYLGFDIPDHQLPADGTGFIVSENGNLQCDACTWTSRKWKHTSEKQNLLVRMFYKS
SNANYEKMKHSSEEERLQIALTDIEKSLGIQGKPQVVEVTNWDGLMPNYHLEHNQAVQSL
NEKLVKIVPNIYVAGASYYGVGIGACIGNGKQTASQIIKALHNCSK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagttcttgttataggtggaggtattacaggcctctccacaatgttttactta
gaaagaatgaaaaaggattacaatctagatttaaatttaatcctagtggaaaaagagaaa
tatttaggcgggaaaattcatagtgtgaaaaagcatggttttattatggagacaggggca
gactctatggttgcacgaaatgaacatgttattcctcttataaaagaattgaatttagaa
gaggagatggtttataacgaaacaggaatttcttacatttattcagataatatgttacat
ccaattcccgctgatactgtatttggaatcccaacaagtgtagaatcattatttcacagt
acattagtttctgcaaaagggaagatcactgcgctaaaagactttattacgaaaaataaa
agtttcacaaaagagacatcgcttgctttatttttggaaagctttttaggaaaagagtta
gtggaaaagcaaattgctcctgtgctttcgggtgtatattctggcaaattacatgaactt
acgatggcatctacattgccatatttagtggactataaaaataagtacggcagtattata
aaaggatttgaagtaaataaaaaacaatttcaggcggctggaaataaaaagtttgtatca
tttaaaaacggattatctacaattattcatcggttagaagagacattaagtgatacggaa
atacgaaaaggaatgctaacaacaaatataagtaaaaacgatgatggatatgaagtttct
tttgtgaatggagaaacagtaaaagcagattgtgtcgtgctagctgttccacatgatgtt
gcacaaacaattttacattctcgtgatttggacgatgaatttgataaatttaagaactca
tcgcttgtaagtatttatttagggtttgatatacctgatcatcaattaccggcagatgga
actggctttattgtttcggaaaacggaaatttacaatgtgatgcttgtacttggacaagt
agaaaatggaaacacacgtcagaaaagcaaaatttactagtgagaatgttttataaaagt
tcaaacgcaaattacgaaaaaatgaaacatagtagtgaagaagaacgtcttcaaattgct
ttaacggatattgaaaaaagtcttggaattcaggggaaaccacaagtagttgaagttaca
aattgggatggcttaatgccaaattatcatttagagcataatcaagcagttcaatcttta
aatgaaaaattagtaaaaattgttccgaatatttatgtagctggagcttcttattacggt
gtaggtattggagcttgtataggaaacggaaaacaaacagcaagtcaaattataaaagca
ttacataattgctcaaagtaa

DBGET integrated database retrieval system