KEGG   Bacillus cytotoxicus: Bcer98_1794Help
Entry
Bcer98_1794       CDS       T00560                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcy  Bacillus cytotoxicus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcer98_1794 (gpmA)
   01230 Biosynthesis of amino acids
    Bcer98_1794 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcer98_1794 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Bcer98_1794 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcer98_1794 (gpmA)
Enzymes [BR:bcy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bcer98_1794 (gpmA)
Exosome [BR:bcy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bcer98_1794 (gpmA)
  Exosomal proteins of melanoma cells
   Bcer98_1794 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1912336..1913073
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLHEARTAGAILKKNGYTFDVAYTSVLKR
AIRTLWIILHEMDLAWVPVHKSWKLNERHYGALQGLNKDETAKKYGEEQVHIWRRSTNVR
PPALAEDDPRYEVTDPRYKRLKKGEFPLTECLEDTEKRVLEFWHKEIAPMLCSNQKVIIS
SHGNTIRSLVKYLDHLSDDGVVSLNIPTGIPLVYELDEHLHPIRHYYLNMDGEVQEGVIP
KHISF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgacacggacaaagtttatggaatttagaaaatcggttt
acaggatggacagatgtagatttatccgaaaatggattacatgaagcgcgaacagctggt
gcgatattaaaaaagaatggctatacatttgatgttgcatacacatcggtattaaaaagg
gctattcggacattatggatcattcttcatgagatggaccttgcttgggttcctgtacat
aaatcatggaaattaaatgaaagacattacggagcattacaaggattaaataaggatgaa
acagctaaaaaatatggagaggagcaggttcatatttggagacgaagtacaaatgtaaga
ccgccagctcttgccgaagatgatccaagatatgaagtcactgatccaagatataagcga
ttaaaaaaaggtgagtttccactgacagagtgcttagaggatacggaaaaaagagtacta
gaattttggcataaagaaattgcacctatgctatgctcaaatcaaaaagtcattatatca
tcgcacggtaatacgattcgctctctcgtgaagtatttagaccatctttccgatgatgga
gtggtttcattaaatattcctactggtattccgcttgtttatgaattagatgagcattta
catccaatccgtcactactatttaaatatggatggtgaagtacaagaaggtgttattcca
aaacacatttctttttaa

DBGET integrated database retrieval system