KEGG   Bacillus cytotoxicus: Bcer98_2488Help
Entry
Bcer98_2488       CDS       T00560                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00020  Citrate cycle (TCA cycle)
bcy00640  Propanoate metabolism
bcy00660  C5-Branched dibasic acid metabolism
bcy01100  Metabolic pathways
bcy01110  Biosynthesis of secondary metabolites
bcy01120  Microbial metabolism in diverse environments
bcy01130  Biosynthesis of antibiotics
bcy01200  Carbon metabolism
Module
bcy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcer98_2488
   00640 Propanoate metabolism
    Bcer98_2488
   00660 C5-Branched dibasic acid metabolism
    Bcer98_2488
Enzymes [BR:bcy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bcer98_2488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABS22724
JGI: Bcer982488
UniProt: A7GRG6
Position
complement(2587310..2588470)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKAILRSYGVSVPNGKVAFTVEEAVEAAKELGTDVCVVKAQIHAGGRGKAGGV
KVAKNLEEVRTYAENILGSTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQ
VVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFHINIPKELVGQAVKF
MMGLYRVFIEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRHKDILELRDLDEEDP
KEIEASKYDLNYIPLDGNIGCMVNGAGLAMATMDIIKHYHGDPANFLDVGGGATAEKVTE
AFKIILSDKNVKGIFVNIFGGIMKCDVIAEGVVEATKQVGLELPLVVRLEGTNVELGKKI
LNESGLNIVAAESMADGAQKIVSLVG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaaggtaaggcgatccttagaagctatggggttagcgttccg
aacgggaaggttgcatttacagtagaagaagctgtagaagctgcgaaagaattaggcaca
gacgtatgtgtagtaaaagcgcaaattcacgctggtggacgcggcaaagccggcggtgta
aaagttgcaaaaaatttagaagaagttcgtacatatgcggaaaatattttaggtagtacg
cttgttacacatcaaacaggtcctgaaggtaaggaagtaaaacgcttacttatcgaggaa
ggatgcgacattaaaaaagaatattatgtaggtcttgtgttagatcgtgcaacttctcaa
gttgttttaatggcttctgaagaaggtggaacagaaatcgaagaagtagcagaaaaaaca
ccagaaaaaatctttaaagaatatatcgatccggcagtaggtttacaaggcttccaagcg
cgccgaatcgcatttcatatcaatatcccaaaagagcttgttggacaagctgtgaagttt
atgatgggcttatatcgcgtatttatcgaaaaagactgctctattgcggaaatcaaccca
cttgttacaacaggcgacggtaaagttatggcactagatgcgaaattaaattttgattcg
aatgcattatatcgtcacaaagacattttagagctccgtgatcttgatgaagaagatcca
aaagaaattgaagcttctaaatatgatttaaactatattcctttagatggaaatatcggt
tgtatggttaacggtgctggtttagcgatggccacaatggatattattaagcattatcat
ggtgatccagctaactttttagatgttggtggtggcgctacagctgaaaaagttacagaa
gcattcaaaattatcctttctgacaaaaacgtaaaaggtatttttgttaatatttttggt
ggcattatgaaatgtgatgtaatcgcagaaggcgttgttgaagcaacaaaacaagtagga
ttagaattaccacttgttgttcgtctggaaggtacaaatgtagaattaggtaagaaaatt
ttaaatgaatctggtttaaatattgttgcagcagaatctatggcagacggtgcgcaaaaa
attgtttcactagtgggctaa

DBGET integrated database retrieval system