KEGG   Bacillus cytotoxicus: Bcer98_2538Help
Entry
Bcer98_2538       CDS       T00560                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00240  Pyrimidine metabolism
bcy00250  Alanine, aspartate and glutamate metabolism
bcy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bcer98_2538
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcer98_2538
Enzymes [BR:bcy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Bcer98_2538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABS22772
JGI: Bcer982538
UniProt: A7GRL4
Position
complement(2639157..2640071)
Genome map
AA seq 304 aa AA seqDB search
MSQLLTMSELSKEEISEILKDAEDFANGKERKATEQTFVANLFFENSTRTRFSFEVAEKR
LGLEVLNFSADSSSVQKGETLYDTIRTLESIGAKAVVIRHQQDRYFDELKDKVNIPILNA
GDGCGNHPTQCLLDLLTIKQEFGRFEGLKIAIVGDIRHSRVARSNAEALTKLGATIYFAS
PEEWKDETNTFGTYRSLDELIPEVDVMMLLRVQHERHDHYETDIMKEYHENHGLTMEREE
RMKEGSIIMHPAPVNRDVEIASELVECKRSRIFKQMENGVYVRMAVLKRALPNVLGGMKH
ELFV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagccaattgttaacgatgagtgaattatcgaaggaagaaatttcagaaatcctaaaa
gatgcagaagatttcgcgaatggaaaagaaagaaaagcgacagagcaaacatttgtagca
aacttgttttttgagaatagtacgagaacaagatttagcttcgaggttgctgagaagaga
ttgggattagaagtattaaacttctcagcagattcttctagcgtacaaaaaggagaaacg
ttatacgatacgataagaacactagaatcgattggagccaaagcagtagtcatccgccat
cagcaagatcgctactttgatgagctaaaagacaaagtaaatatccctattttaaatgca
ggtgatggatgtggaaatcacccgacgcaatgtttgttagatcttctaacaattaaacaa
gagtttgggagatttgaaggattaaagattgcgattgtaggagacattcgtcacagccga
gtggcacgctcgaatgcagaagcattaacgaaattaggtgcaacaatttactttgctagt
cctgaagagtggaaagatgaaacaaatacattcggaacatatagaagcttagatgaactt
attccagaagttgatgtgatgatgttacttcgtgtacagcatgagcgtcatgatcattat
gaaacagacatcatgaaagagtatcatgaaaaccatgggttaacaatggaacgagaagaa
cgcatgaaagaaggaagcattattatgcatccggctccagtaaatcgtgatgtagaaatt
gcaagtgaacttgttgagtgtaaacgttctcgcatattcaaacagatggaaaatggagtt
tacgtaagaatggctgttttaaaacgcgcattaccaaatgtattaggaggaatgaaacat
gaattatttgtttaa

DBGET integrated database retrieval system