KEGG   Bacillus cytotoxicus NVH 391-98: Bcer98_2538Help
Entry
Bcer98_2538       CDS       T00560                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bcy  Bacillus cytotoxicus NVH 391-98
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bcy00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bcy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2639157..2640071)
Genome map
AA seq 304 aa AA seqDB search
MSQLLTMSELSKEEISEILKDAEDFANGKERKATEQTFVANLFFENSTRTRFSFEVAEKR
LGLEVLNFSADSSSVQKGETLYDTIRTLESIGAKAVVIRHQQDRYFDELKDKVNIPILNA
GDGCGNHPTQCLLDLLTIKQEFGRFEGLKIAIVGDIRHSRVARSNAEALTKLGATIYFAS
PEEWKDETNTFGTYRSLDELIPEVDVMMLLRVQHERHDHYETDIMKEYHENHGLTMEREE
RMKEGSIIMHPAPVNRDVEIASELVECKRSRIFKQMENGVYVRMAVLKRALPNVLGGMKH
ELFV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagccaattgttaacgatgagtgaattatcgaaggaagaaatttcagaaatcctaaaa
gatgcagaagatttcgcgaatggaaaagaaagaaaagcgacagagcaaacatttgtagca
aacttgttttttgagaatagtacgagaacaagatttagcttcgaggttgctgagaagaga
ttgggattagaagtattaaacttctcagcagattcttctagcgtacaaaaaggagaaacg
ttatacgatacgataagaacactagaatcgattggagccaaagcagtagtcatccgccat
cagcaagatcgctactttgatgagctaaaagacaaagtaaatatccctattttaaatgca
ggtgatggatgtggaaatcacccgacgcaatgtttgttagatcttctaacaattaaacaa
gagtttgggagatttgaaggattaaagattgcgattgtaggagacattcgtcacagccga
gtggcacgctcgaatgcagaagcattaacgaaattaggtgcaacaatttactttgctagt
cctgaagagtggaaagatgaaacaaatacattcggaacatatagaagcttagatgaactt
attccagaagttgatgtgatgatgttacttcgtgtacagcatgagcgtcatgatcattat
gaaacagacatcatgaaagagtatcatgaaaaccatgggttaacaatggaacgagaagaa
cgcatgaaagaaggaagcattattatgcatccggctccagtaaatcgtgatgtagaaatt
gcaagtgaacttgttgagtgtaaacgttctcgcatattcaaacagatggaaaatggagtt
tacgtaagaatggctgttttaaaacgcgcattaccaaatgtattaggaggaatgaaacat
gaattatttgtttaa

DBGET integrated database retrieval system