KEGG   Bacillus cytotoxicus NVH 391-98: Bcer98_2729Help
Entry
Bcer98_2729       CDS       T00560                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bcy  Bacillus cytotoxicus NVH 391-98
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bcy00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bcy00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2814642..2815418
Genome map
AA seq 258 aa AA seqDB search
MVTNQVIFLTGAASGIGYEMATTFAKEGAKVVVSDRLKERAKSAAEQLQKMGHTAIGLKC
DVTSEQEIEEAIAKTVAEFGSLHVLINNAGMQHVSPIDEFPTDTFELLIKIMQIAPFIAI
KHAFPIMKKQQYGRIINIASINGLVGFAGKAAYNSAKHGVIGLTKVAALEGATHGITVNA
LCPGYVDTPLVRNQLQDLAHTRNVPLKRVLEDVIYPLVPQKRLLEVQEIASYALFLASEQ
AKGITGQAVVIDGGYTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggttacaaaccaggttatttttctaacaggtgcggcgagtggtattggatatgaaatg
gctactacctttgcaaaagaaggagcaaaagttgtcgtgagcgatcgccttaaagagcgc
gccaaaagtgcggctgaacagttacaaaagatgggtcatacagcaattggattaaaatgt
gacgtgacgtccgagcaagaaatcgaggaagccattgctaaaacagtagcagaatttggt
tcgttacatgtcctaatcaataacgccggtatgcaacatgtttcccccattgatgaattt
ccaactgatacgttcgagcttcttattaaaattatgcagattgcaccgtttatcgcaata
aaacatgcctttcctattatgaaaaaacaacaatatgggcgcattattaatattgcctcg
attaatggactcgttggcttcgctggaaaagctgcttataatagcgccaaacacggtgta
attggattaacaaaagtagctgcgttagaaggggcaacgcatggaattacagtaaatgcc
ctttgtccaggatacgttgatactcctcttgtccgcaatcaactccaagacctagctcat
acgagaaatgtaccacttaagcgcgtattagaagatgttatttaccctcttgtgccgcaa
aaaagattactggaagtacaagagattgctagctacgccttatttttagccagtgaacaa
gcaaaaggaataactggacaagccgttgtaattgatggaggctatacagcccaataa

DBGET integrated database retrieval system