KEGG   Bacillus cytotoxicus: Bcer98_2738Help
Entry
Bcer98_2738       CDS       T00560                                 

Definition
(GenBank) Acireductone dioxygenase ARD
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00270  Cysteine and methionine metabolism
bcy01100  Metabolic pathways
Module
bcy_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Bcer98_2738
Enzymes [BR:bcy01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Bcer98_2738
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Bcer98_2738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding DUF3418 Cupin_3 SF-assemblin
Motif
Other DBs
NCBI-ProteinID: ABS22971
JGI: Bcer982738
UniProt: A7GS63
Position
2823047..2823559
Genome map
AA seq 170 aa AA seqDB search
MAQIRIHEINTRIENEKEVQLFLQKEDVLYEKWDISKLPAHLQNNYALTDENKEEILTLF
SNEIADVSQRRGYKAHDIISLSSATPNLDELLINFKQEHHHTDDEVRFIVSGHGIFAIQG
KDGRFFDVELEPGDLISVPENVRHYFTLQDDRQVVAIRIFVTTAGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaaattcgtattcatgaaataaatactcgcattgaaaatgaaaaagaagtacag
ctgtttttgcaaaaagaagatgtactatatgagaaatgggacatttctaaattacctgcg
catttacaaaataactatgctttaactgatgaaaataaggaagaaattttaactttattt
tccaacgaaatagcagatgtttcacagcgccgtggttataaagcacatgatatcatttct
ctttcaagtgcaacacctaatctggatgagttactcattaactttaaacaagaacaccac
catactgacgatgaagttcgcttcattgtcagcggccatggcatttttgctatccaaggc
aaagacggtcgtttttttgatgttgaacttgagccaggcgatctcatttctgtacctgaa
aatgtaagacattattttactttacaagatgatcgccaagttgtagccattcgtattttt
gttacaacagcaggctgggttcctatttactaa

DBGET integrated database retrieval system