KEGG   Bacillus cytotoxicus: Bcer98_2991Help
Entry
Bcer98_2991       CDS       T00560                                 

Definition
(GenBank) putative glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00010  Glycolysis / Gluconeogenesis
bcy00052  Galactose metabolism
bcy00500  Starch and sucrose metabolism
bcy00520  Amino sugar and nucleotide sugar metabolism
bcy00521  Streptomycin biosynthesis
bcy01100  Metabolic pathways
bcy01110  Biosynthesis of secondary metabolites
bcy01120  Microbial metabolism in diverse environments
bcy01130  Biosynthesis of antibiotics
bcy01200  Carbon metabolism
Module
bcy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcer98_2991
   00052 Galactose metabolism
    Bcer98_2991
   00500 Starch and sucrose metabolism
    Bcer98_2991
   00520 Amino sugar and nucleotide sugar metabolism
    Bcer98_2991
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bcer98_2991
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Bcer98_2991
Enzymes [BR:bcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bcer98_2991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABS23218
JGI: Bcer982991
UniProt: A7GSW0
Position
complement(3039292..3040275)
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTDTSEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVATGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAF
GEMWKGAGEGAKDLVCMTLGTGVGGGVITNGEIVHGASGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQKMQETEKESILRSMLAEEGRITSKDVFEALGQGDELAAEV
VEKIASYLGLAVANLASTLNPEKIVIGGGVSKAGDALLEPTQRYFEQYAFSRARKSTKLA
IATLGNDAGVIGGAWLVKKQQYEVKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgacctgggtgggacgacaattaaattagcattt
attaatgtgtacggtgaaattttacacaagtgggaaatcccaacagatactagtgaacaa
ggaaaacatattacactagatgtagccaaagcaatcgataaaaaattagaagaattaggc
gaattaaagagtaaattaattggtattggtatgggtgctccgggtcctgtccatgtagct
acaggcatgatttatgaagcggttaacttagggtggaaaaactatccattaaaagattta
ttagaagttgaaacaggtttacctgttgttattgataacgatgccaacttagcagcattt
ggggaaatgtggaagggtgctggagaaggtgcgaaagatcttgtttgtatgacgcttgga
actggtgttggtggcggtgttattaccaatggtgaaatcgttcatggtgcaagcggtgca
gctggtgaaattggccatattacagtcgttacagaaaatgcatttccttgtaattgcggg
aaatctggttgcttagagacagtggcatccgcaacagggattgttcgtgttgctatgcaa
aaaatgcaagaaacagagaaggaaagtatactgcgttcgatgttggctgaagaaggccgt
attacatcaaaagatgtatttgaagcattaggacaaggtgatgaattagcagctgaagta
gtagaaaaaatcgcttcttatttaggattagctgtagcaaaccttgcaagtacattaaac
cctgaaaaaattgtaattggtggcggcgtctctaaagcaggtgatgcgctattagaacca
acgcaacgctattttgaacaatacgcattctcacgtgctagaaagagcacaaagctagca
attgcaacgcttggtaatgatgcgggtgtaattggaggagcttggcttgtaaaaaagcag
caatacgaagtgaagatgatataa

DBGET integrated database retrieval system