KEGG   Bacillus cytotoxicus: Bcer98_3138Help
Entry
Bcer98_3138       CDS       T00560                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bcy  Bacillus cytotoxicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bcer98_3138
Enzymes [BR:bcy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Bcer98_3138
DNA repair and recombination proteins [BR:bcy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Bcer98_3138
    RecFOR pathway proteins
     Bcer98_3138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3186054..3186671)
Genome map
AA seq 205 aa AA seqDB search
MFEYVTGYVEYVGPEYIVLDHNGIGYQIFTPNPYVFQRSKQEIRVYTYHYVREDIMALYG
FKTREERLLFTKLLGVSGIGPKGALAILASGQTGQVVQAIENEDERFLVKFPGVGKKTAR
QMILDLKGKLADVVPDVFVDLFSDEERFDEKKGSSTELDEALEALRALGYAEREINRVLP
ELLKESLTTDQYIKKALSLLLNGKR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgagtatgttacaggttatgtagagtacgtaggaccggaatatatcgttcttgac
cataatggaattggctaccaaatttttacgccaaacccatatgtattccaaagaagtaag
caagaaattcgggtatacacatatcactatgtaagagaagatataatggcactttacggt
tttaagacacgtgaagagcgtttactattcacaaaacttttgggtgtatcgggaattggg
ccaaaaggtgcgcttgccattttagcctcaggtcaaacagggcaggttgtacaagcgatt
gagaacgaagatgagaggtttttagtgaagtttccaggtgttggaaagaaaacggcgcgt
caaatgattttagatttaaaaggaaaattagctgatgttgtaccagatgtattcgtggat
ttattctcagacgaagagcgctttgatgagaaaaaaggttcatcaactgaactggatgag
gcgcttgaagcgctccgtgcacttggttatgcagaacgcgaaatcaatcgcgtcttgcca
gagttattaaaagagtcattgacgacggatcagtatattaaaaaggcgcttagtctttta
ctaaatggtaagaggtga

DBGET integrated database retrieval system