KEGG   Bacillus cytotoxicus: Bcer98_3257Help
Entry
Bcer98_3257       CDS       T00560                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
bcy  Bacillus cytotoxicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3323571..3324656)
Genome map
AA seq 361 aa AA seqDB search
MQKLDKTLTMLKELTDARGIAGNEREPREVMKKYIEPFADELSTDNLGSLVAKKVGEENG
PKIMVAGHLDEVGFMITQIDNKGFLRFQTVGGWWSQVMLAQRVTIITCKGDITGVIGSKP
PHILSAEARKKPVEIKDMFIDIGASSKEEAMEWGVRPGDQVVPYFEFQVMKNEKLLLAKA
WDNRIGCAITIDVLRQLKDEKHPNIVYGVGTVQEEVGLRGAKTSANYIKPDIAFAVDVGI
AGDTPGVTEKEAQSKMGDGPQIILYDASVIGHTGLRNFVVDVADELDIPYQYDFVAGGGT
DAGAIHISVNGIPSMAITIATRYIHSHAAMLHRDDYENAVKLIVEVIKRLDKEAVHNITF
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagttagataaaacattgacaatgctgaaagaactaacagatgcgcgcggtatt
gcgggaaatgagcgtgagccacgtgaagtaatgaaaaagtacattgaaccgtttgcggat
gaactttctacagataatttaggaagtttagttgctaaaaaggtaggagaagaaaacggt
ccgaaaattatggtagctggtcatttagatgaagtgggctttatgattacacaaatcgat
aataaaggttttcttcgttttcaaacggtaggtggctggtggtcacaagttatgcttgca
cagcgtgtaacaattataacgtgcaaaggggatataacaggtgtaattggttcaaaacca
ccacacattttatcagcagaagctcgtaaaaaaccagttgaaattaaggacatgttcatc
gatatcggtgcttctagcaaagaagaagcaatggaatggggcgtacgaccaggagatcaa
gttgtaccatatttcgaattccaagtgatgaaaaatgaaaaactgctgcttgcaaaagcg
tgggataaccgcattggttgtgctattacgattgatgtattaagacaattaaaagatgaa
aaacatccaaacattgtatacggtgttggaacagttcaagaagaagtaggactgcgcggt
gcgaaaacgtcagcaaactatattaaacccgacattgcgtttgcagtagatgttggaatt
gctggcgatacaccgggagtaacagaaaaagaagcgcaaagtaaaatgggagatgggcca
caaatcattttatatgatgcatctgtcattggtcatactgggcttcgtaatttcgtagtg
gatgttgctgatgagctagatattccatatcaatacgactttgtagctggaggcggaact
gatgcaggggcgattcatatttctgtaaatggtattccatctatggcaattacaattgca
actcgttacattcactctcatgctgctatgttgcatcgtgacgattatgaaaatgcagtg
aaactcattgtagaagtgattaaacgtcttgataaagaggctgtacataatattacattt
gattaa

DBGET integrated database retrieval system