KEGG   Bacillus cytotoxicus: Bcer98_3257Help
Entry
Bcer98_3257       CDS       T00560                                 

Definition
(GenBank) Cellulase
Organism
bcy  Bacillus cytotoxicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 Peptidase_M18 SurE DUF859
Motif
Other DBs
NCBI-ProteinID: ABS23476
JGI: Bcer983257
UniProt: A7GTL8
Position
complement(3323571..3324656)
Genome map
AA seq 361 aa AA seqDB search
MQKLDKTLTMLKELTDARGIAGNEREPREVMKKYIEPFADELSTDNLGSLVAKKVGEENG
PKIMVAGHLDEVGFMITQIDNKGFLRFQTVGGWWSQVMLAQRVTIITCKGDITGVIGSKP
PHILSAEARKKPVEIKDMFIDIGASSKEEAMEWGVRPGDQVVPYFEFQVMKNEKLLLAKA
WDNRIGCAITIDVLRQLKDEKHPNIVYGVGTVQEEVGLRGAKTSANYIKPDIAFAVDVGI
AGDTPGVTEKEAQSKMGDGPQIILYDASVIGHTGLRNFVVDVADELDIPYQYDFVAGGGT
DAGAIHISVNGIPSMAITIATRYIHSHAAMLHRDDYENAVKLIVEVIKRLDKEAVHNITF
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagttagataaaacattgacaatgctgaaagaactaacagatgcgcgcggtatt
gcgggaaatgagcgtgagccacgtgaagtaatgaaaaagtacattgaaccgtttgcggat
gaactttctacagataatttaggaagtttagttgctaaaaaggtaggagaagaaaacggt
ccgaaaattatggtagctggtcatttagatgaagtgggctttatgattacacaaatcgat
aataaaggttttcttcgttttcaaacggtaggtggctggtggtcacaagttatgcttgca
cagcgtgtaacaattataacgtgcaaaggggatataacaggtgtaattggttcaaaacca
ccacacattttatcagcagaagctcgtaaaaaaccagttgaaattaaggacatgttcatc
gatatcggtgcttctagcaaagaagaagcaatggaatggggcgtacgaccaggagatcaa
gttgtaccatatttcgaattccaagtgatgaaaaatgaaaaactgctgcttgcaaaagcg
tgggataaccgcattggttgtgctattacgattgatgtattaagacaattaaaagatgaa
aaacatccaaacattgtatacggtgttggaacagttcaagaagaagtaggactgcgcggt
gcgaaaacgtcagcaaactatattaaacccgacattgcgtttgcagtagatgttggaatt
gctggcgatacaccgggagtaacagaaaaagaagcgcaaagtaaaatgggagatgggcca
caaatcattttatatgatgcatctgtcattggtcatactgggcttcgtaatttcgtagtg
gatgttgctgatgagctagatattccatatcaatacgactttgtagctggaggcggaact
gatgcaggggcgattcatatttctgtaaatggtattccatctatggcaattacaattgca
actcgttacattcactctcatgctgctatgttgcatcgtgacgattatgaaaatgcagtg
aaactcattgtagaagtgattaaacgtcttgataaagaggctgtacataatattacattt
gattaa

DBGET integrated database retrieval system