KEGG   Bacillus cytotoxicus NVH 391-98: Bcer98_3283Help
Entry
Bcer98_3283       CDS       T00560                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bcy  Bacillus cytotoxicus NVH 391-98
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bcy01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bcy01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bcy00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bcy00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bcy00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bcy00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:bcy00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3353496..3354455)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHDIEVYGIYHGYAGLISGHIEKLELGSVGDI
IHRGGTKLYTARCPEFKDPAVREKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLADGAETILIPEAEYDMDDVIARLKRGSERGKKHSIIVVAEGVGSAIDIGKKIEEATNF
DTRVTVLGHVQRGGSPSAQDRVLASRLGARAVELLMEGKGGRCVGIQNNKLVDHDIIEAL
AQKHVIDIDMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtgtattaacgagtggtggagattcacctggtatgaacgctgctatt
cgtgcagttgttcgtaaagcgatttaccatgatattgaagtatatggtatctaccatgga
tatgctggactaatttctggtcacattgaaaaattagaacttggttctgttggcgatatt
atccaccgtggtggtacaaaattatatacagcaagatgccctgagtttaaagatccagct
gttcgtgaaaaaggaatcgaacaattaaagaaacatggcattgaaggacttgttgttatt
ggtggagacggttcttaccaaggagctaaaaaactaacagagcaaggattcccttgtgta
ggtgtaccaggtacaatcgacaatgatattcctggaacagactttacaattggattcgat
actgctttaaatactgttattgatgcaattgataaaattcgtgatacagctacatctcat
gaacgtacatacgttattgaagtaatggggcgtcacgctggcgacatcgcattatgggct
ggtttagctgatggtgcagagacaatcttgattccagaagcagaatatgatatggatgat
gtaattgctcgtttaaaacgcggtagcgaacgtggtaaaaaacatagtatcatcgttgta
gctgaaggtgttggaagtgcgattgatatcggtaagaaaattgaggaagcgacaaacttt
gatactcgtgtaacagtattaggtcatgtacaacgtggtggatcaccaagtgcacaagac
cgtgtgttagcgagtcgccttggcgcaagagcagttgaattattaatggaaggtaagggc
ggacgttgtgttggtatccaaaacaacaaactcgttgatcatgatattatcgaagcgtta
gctcaaaaacatgtaattgatatagatatgtatcaattatctaaagaattatccatctaa

DBGET integrated database retrieval system