KEGG   Bacillus cytotoxicus: Bcer98_3283Help
Entry
Bcer98_3283       CDS       T00560                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bcy  Bacillus cytotoxicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcer98_3283
   01230 Biosynthesis of amino acids
    Bcer98_3283
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcer98_3283
   00030 Pentose phosphate pathway
    Bcer98_3283
   00051 Fructose and mannose metabolism
    Bcer98_3283
   00052 Galactose metabolism
    Bcer98_3283
  Energy metabolism
   00680 Methane metabolism
    Bcer98_3283
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Bcer98_3283
Enzymes [BR:bcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bcer98_3283
Protein phosphatases and associated proteins [BR:bcy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Bcer98_3283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3353496..3354455)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHDIEVYGIYHGYAGLISGHIEKLELGSVGDI
IHRGGTKLYTARCPEFKDPAVREKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLADGAETILIPEAEYDMDDVIARLKRGSERGKKHSIIVVAEGVGSAIDIGKKIEEATNF
DTRVTVLGHVQRGGSPSAQDRVLASRLGARAVELLMEGKGGRCVGIQNNKLVDHDIIEAL
AQKHVIDIDMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtgtattaacgagtggtggagattcacctggtatgaacgctgctatt
cgtgcagttgttcgtaaagcgatttaccatgatattgaagtatatggtatctaccatgga
tatgctggactaatttctggtcacattgaaaaattagaacttggttctgttggcgatatt
atccaccgtggtggtacaaaattatatacagcaagatgccctgagtttaaagatccagct
gttcgtgaaaaaggaatcgaacaattaaagaaacatggcattgaaggacttgttgttatt
ggtggagacggttcttaccaaggagctaaaaaactaacagagcaaggattcccttgtgta
ggtgtaccaggtacaatcgacaatgatattcctggaacagactttacaattggattcgat
actgctttaaatactgttattgatgcaattgataaaattcgtgatacagctacatctcat
gaacgtacatacgttattgaagtaatggggcgtcacgctggcgacatcgcattatgggct
ggtttagctgatggtgcagagacaatcttgattccagaagcagaatatgatatggatgat
gtaattgctcgtttaaaacgcggtagcgaacgtggtaaaaaacatagtatcatcgttgta
gctgaaggtgttggaagtgcgattgatatcggtaagaaaattgaggaagcgacaaacttt
gatactcgtgtaacagtattaggtcatgtacaacgtggtggatcaccaagtgcacaagac
cgtgtgttagcgagtcgccttggcgcaagagcagttgaattattaatggaaggtaagggc
ggacgttgtgttggtatccaaaacaacaaactcgttgatcatgatattatcgaagcgtta
gctcaaaaacatgtaattgatatagatatgtatcaattatctaaagaattatccatctaa

DBGET integrated database retrieval system