KEGG   Bacillus cytotoxicus: Bcer98_3430Help
Entry
Bcer98_3430       CDS       T00560                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bcer98_3430
Enzymes [BR:bcy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bcer98_3430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 LCAT Abhydrolase_5 Ser_hydrolase PGAP1 LIDHydrolase DUF676 PhoPQ_related Abhydrolase_3 DUF915 DUF1350 DUF900
Motif
Other DBs
NCBI-ProteinID: ABS23642
JGI: Bcer983430
UniProt: A7GU34
Position
complement(3492903..3493706)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAESAKAVIVIVHGAMEYHGRYEALAEEWNHIGYHVVMGDLPAHGTTSRNRGHINS
FDEYIEEVKVWIKEARKYRLPIFLLGHSMGGLIIIRMMEETKREDIDGIILSSPCLGVLA
TPAAPLRALAKVLNIVMPKLQFPTNLTVEMSTRNKEVRDAMENDSLFLRKVSVRWYSELI
KSTRIAHEKIDEFPDVPLLLMQACEDKLVDKTSVRKWFDNLKISDKAYKEWPNCYHELLN
EYERDEVFNYIKSFTEMHVNNRIETNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagcggaatcggcaaaggctgttatcgtaattgtgcatggtgccatg
gaataccatggacgttatgaagcgctggcagaagagtggaatcacattgggtatcatgtt
gttatgggagatcttcctgctcatggaacaacgtcaagaaatagaggacatattaattcg
tttgatgaatacatagaagaggtcaaagtatggataaaagaagcgagaaagtatagacta
cctatttttttattgggacatagtatggggggacttatcatcattcgaatgatggaagaa
acgaagcgcgaagatatagatggtattatattaagttcaccatgcttaggggtgttagct
actccagcggcaccacttcgagctctggcgaaggtattaaatattgttatgccgaaatta
caatttccgacgaatcttacagtggaaatgtcaacaagaaataaagaagttcgcgatgca
atggaaaatgattcattgttcttgcgcaaggtatccgttcgctggtatagtgaattgata
aaatctacacgaattgctcatgaaaaaatagatgagttcccagacgttccgctcttgcta
atgcaggcgtgtgaggataaactagtagataaaacaagtgtccgtaaatggtttgataat
ttaaaaatcagtgataaggcgtataaagaatggccgaattgttatcatgagttattaaat
gagtatgagcgagatgaagtttttaattatatcaagtcatttactgaaatgcatgtcaat
aacagaatagaaacaaataaataa

DBGET integrated database retrieval system