KEGG   Bacillus cytotoxicus: Bcer98_3680Help
Entry
Bcer98_3680       CDS       T00560                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00010  Glycolysis / Gluconeogenesis
bcy00051  Fructose and mannose metabolism
bcy00562  Inositol phosphate metabolism
bcy01100  Metabolic pathways
bcy01110  Biosynthesis of secondary metabolites
bcy01120  Microbial metabolism in diverse environments
bcy01130  Biosynthesis of antibiotics
bcy01200  Carbon metabolism
bcy01230  Biosynthesis of amino acids
Module
bcy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcy_M00002  Glycolysis, core module involving three-carbon compounds
bcy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcer98_3680
   00051 Fructose and mannose metabolism
    Bcer98_3680
   00562 Inositol phosphate metabolism
    Bcer98_3680
Enzymes [BR:bcy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bcer98_3680
Exosome [BR:bcy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bcer98_3680
  Exosomal proteins of bladder cancer cells
   Bcer98_3680
  Exosomal proteins of melanoma cells
   Bcer98_3680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABS23877
JGI: Bcer983680
UniProt: A7GUR9
Position
complement(3740082..3740837)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATQGTDLK
VGAQNMHFEKNGAFTGEISPVALSDLKVSYVVLGHSERREMFAETDETVNKKTLAAFEHG
LTPIVCCGETLEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSA
EDANEVCAHIRKVVAEAVSPAAAEAVRIQYGGSVKPGNIKEYMAQPDIDGALVGGASLEP
ASFLGLLEAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaataaaactctatctgaagcagtt
agcttcgtagaagaagtaaaaggtcaaattccagcagcttcagctgttgatgcagttgtt
tgctctccagctctattcttagagcgtttagtagcagcgacgcaaggaactgacttaaaa
gtaggtgcacaaaacatgcacttcgaaaaaaatggtgcattcactggtgagattagccca
gtagcacttagcgacttaaaagtgagctacgtagtacttggtcactctgaacgtcgtgaa
atgtttgctgaaacagatgaaacagtaaataaaaaaacacttgcagcatttgaacatggt
ttaacaccaatcgtttgctgtggtgaaactttagaagaacgtgaaagcggaaaaacattt
gatctagtagcaggccaagtgacaaaagcacttgcaggcttaacagaagaacaagtgaaa
gctactgttatcgcatatgagccaatttgggcaatcggtacaggaaaatcttcttctgca
gaagatgcaaacgaagtatgtgcacacatccgtaaagttgttgcagaagctgtttctcca
gcagctgcagaagctgttcgtattcaatacggcggtagcgtaaaaccaggaaacattaaa
gaatacatggcacaacctgacatcgacggcgctttagttggcggtgcaagtttagagcca
gcttccttcttaggtcttttggaggcggtaaaatga

DBGET integrated database retrieval system