KEGG   Bacillus cytotoxicus: Bcer98_3680Help
Entry
Bcer98_3680       CDS       T00560                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcy  Bacillus cytotoxicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcer98_3680 (tpiA)
   01230 Biosynthesis of amino acids
    Bcer98_3680 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcer98_3680 (tpiA)
   00051 Fructose and mannose metabolism
    Bcer98_3680 (tpiA)
   00562 Inositol phosphate metabolism
    Bcer98_3680 (tpiA)
Enzymes [BR:bcy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bcer98_3680 (tpiA)
Exosome [BR:bcy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bcer98_3680 (tpiA)
  Exosomal proteins of bladder cancer cells
   Bcer98_3680 (tpiA)
  Exosomal proteins of melanoma cells
   Bcer98_3680 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3740082..3740837)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATQGTDLK
VGAQNMHFEKNGAFTGEISPVALSDLKVSYVVLGHSERREMFAETDETVNKKTLAAFEHG
LTPIVCCGETLEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSA
EDANEVCAHIRKVVAEAVSPAAAEAVRIQYGGSVKPGNIKEYMAQPDIDGALVGGASLEP
ASFLGLLEAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaataaaactctatctgaagcagtt
agcttcgtagaagaagtaaaaggtcaaattccagcagcttcagctgttgatgcagttgtt
tgctctccagctctattcttagagcgtttagtagcagcgacgcaaggaactgacttaaaa
gtaggtgcacaaaacatgcacttcgaaaaaaatggtgcattcactggtgagattagccca
gtagcacttagcgacttaaaagtgagctacgtagtacttggtcactctgaacgtcgtgaa
atgtttgctgaaacagatgaaacagtaaataaaaaaacacttgcagcatttgaacatggt
ttaacaccaatcgtttgctgtggtgaaactttagaagaacgtgaaagcggaaaaacattt
gatctagtagcaggccaagtgacaaaagcacttgcaggcttaacagaagaacaagtgaaa
gctactgttatcgcatatgagccaatttgggcaatcggtacaggaaaatcttcttctgca
gaagatgcaaacgaagtatgtgcacacatccgtaaagttgttgcagaagctgtttctcca
gcagctgcagaagctgttcgtattcaatacggcggtagcgtaaaaccaggaaacattaaa
gaatacatggcacaacctgacatcgacggcgctttagttggcggtgcaagtttagagcca
gcttccttcttaggtcttttggaggcggtaaaatga

DBGET integrated database retrieval system