KEGG   Bacillus cytotoxicus: Bcer98_3883Help
Entry
Bcer98_3883       CDS       T00560                                 

Definition
(GenBank) putative agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00330  Arginine and proline metabolism
bcy01100  Metabolic pathways
Module
bcy_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bcy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bcer98_3883
Enzymes [BR:bcy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Bcer98_3883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ABS24069
JGI: Bcer983883
UniProt: A7GVB1
Position
complement(3942155..3943027)
Genome map
AA seq 290 aa AA seqDB search
MRFDEAYSGKVFIKSHPSFEEAEAVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSP
YLDRELEEVKYFDAGDIPLPFGNPQRSIDMIEEYVTKLLDAGKFPLGLGGEHLVSWPVFK
AMAKKYPDLAIIHMDAHTDLRESYEGEPLSHATPIRKVCDLIGPENVYSFGIRSGMKEEF
EWVKEVGMNLYKFEVLEPLKKVLPKLAGRPVYVTIDIDVLDPAHAPGTGTLEAGGITSKE
LLDSIVAIANSDIKVVGADLVEVAPVYDHSDQTPIAASKFVREMLLGWVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgatgaagcttattcaggtaaagtatttattaaaagtcatccgagttttgaa
gaggcagaagctgttatttacgggatgccaatggattggactgtaagttatcgtccaggt
tctcgcttcggccctgcacgtattcgtgaagtatcaattggactagaagaatacagtcca
tatttagatcgtgaactagaagaagtaaaatattttgatgctggtgatattccactacca
tttggaaatccacagcgcagcatagacatgattgaagaatatgtaacaaaactattagat
gccggtaagtttccactaggtcttggtggtgagcacctagtgtcttggccagtttttaag
gcaatggcaaaaaaatatccggacttagcaatcattcatatggatgctcatactgactta
cgtgagtcctatgaaggggagcctttatcccatgcgacgccaattcgcaaagtatgtgat
ttaattgggccggaaaacgtatattctttcggaattcgttctggtatgaaagaagaattt
gaatgggtaaaagaagtgggcatgaacttatataaatttgaagtgttagagccattaaag
aaagtattgccaaaacttgcaggacgcccagtctatgtcacaatcgacatcgacgtattg
gatccagcacatgcacctggcacaggaacgttagaagctggcggtatcacatctaaagaa
ttattagattccatcgtagcaattgcaaattcagatataaaagtagttggagctgaccta
gtcgaagtagccccagtctacgaccatagtgaccaaaccccaatcgcagcaagtaaattc
gtgcgggaaatgctacttggttgggtaaaataa

DBGET integrated database retrieval system