KEGG   Bacillus cereus ZK: BCZK0422Help
Entry
BCZK0422          CDS       T00198                                 

Gene name
ugtP
Definition
diacylglycerol glucosyltransferase (EC:2.4.1.157)
Orthology
K03429  
1,2-diacylglycerol 3-glucosyltransferase [EC:2.4.1.157]
Organism
bcz  Bacillus cereus ZK
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BCZK0422 (ugtP)
Enzymes [BR:bcz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.157  1,2-diacylglycerol 3-glucosyltransferase
     BCZK0422 (ugtP)
Glycosyltransferases [BR:bcz01003]
 Glycolipid biosynthesis
  Glycoglycerolipid
   BCZK0422 (ugtP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
489267..490433
Genome map
AA seq 388 aa AA seqDB search
MIKNPKVLILTAHYGNGHVQVAKTLEQTFRQKGIKDVIVCDLFGESHPVITDITKYLYLK
SYTIGKELYRLFYYGVEKIYDKKIASWYANFGRKRLKLLLQAEKPDIVINTFPIIAVPEL
KKQTGISIPVYNVLTDFCVHKIWIHREVDRYFVATDHVKKVMVDIGVPAEQIVETGIPIR
SSFELKINPDIIYNKYQLCKNKKILLIVAGAHGVLGSVKELCQSFMSVPDLQVVVVCGKN
EALKQDLVGVQETNPDALKVFGYVENIDELFRVTSCMITKPGGITLSEAAALQVPVILYK
PVPGQENENAMYFERKGAAVVIRDDSEVFAKTEALLKDDMKLLQMKEAMKSIYRPEPADH
IVDTILAENHVEPNHIPIKSPALAQSFT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
ttgataaaaaaccccaaggttttaatattaactgcacattacggtaacggtcatgtgcaa
gtagcgaaaacattagaacaaacatttcgccaaaaaggaattaaagatgtaattgtatgc
gatttgttcggagaatcacatccggttataaccgatattacaaaatatttatatttaaaa
agttatacaattggaaaagaattataccgcttgttttattatggcgtagaaaaaatttat
gataaaaaaatagcatcttggtatgcgaattttggaagaaaacgcttgaaattactttta
caagcagagaaaccggatattgttattaatacctttccgattatagctgtaccagaatta
aaaaagcaaacaggtatttcaattcctgtgtataacgtattaacggatttttgtgtgcac
aaaatatggattcatcgggaagtagatcgttattttgtagcaactgatcacgtaaaaaaa
gttatggttgatatcggtgtgcctgcggagcaaattgttgaaaccggaattccgattcgt
agtagttttgagttaaagatcaatccagacattatatataataaatatcagttatgtaag
aataaaaagattttactaattgtagcaggtgctcatggggtattaggaagtgtaaaagaa
ctatgccaatcatttatgtcagtacctgatttacaagtagttgtcgtttgtgggaaaaat
gaagcattaaaacaggatttggtaggggtacaggaaacaaatcctgatgcattaaaagta
tttggttatgttgaaaatattgatgaactattccgcgttacttcttgtatgattacaaaa
ccaggcggtattacgttaagtgaggcggcagcattgcaagtacctgtcattttatataag
cctgttccaggacaagaaaatgaaaatgcgatgtactttgaaagaaaaggagctgcagtt
gtcattcgtgatgatagtgaggtttttgcaaaaacagaggcgttattaaaagacgatatg
aagcttcttcaaatgaaagaagcgatgaaaagcatttatcgtccggagccagctgatcat
attgtggatacaattttggcggaaaatcatgtagaaccgaatcatatacctattaaatca
cctgctcttgcacaatcatttacttaa

DBGET integrated database retrieval system