KEGG   Bacillus cereus E33L: BCE33L3329Help
Entry
BCE33L3329        CDS       T00198                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcz  Bacillus cereus E33L
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCE33L3329 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BCE33L3329 (mmgA)
   00640 Propanoate metabolism
    BCE33L3329 (mmgA)
   00650 Butanoate metabolism
    BCE33L3329 (mmgA)
  Lipid metabolism
   00071 Fatty acid degradation
    BCE33L3329 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BCE33L3329 (mmgA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCE33L3329 (mmgA)
   00310 Lysine degradation
    BCE33L3329 (mmgA)
   00380 Tryptophan metabolism
    BCE33L3329 (mmgA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCE33L3329 (mmgA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCE33L3329 (mmgA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCE33L3329 (mmgA)
Enzymes [BR:bcz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCE33L3329 (mmgA)
Exosome [BR:bcz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCE33L3329 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3462270..3463361)
Genome map
AA seq 363 aa AA seqDB search
MNRAVIVEAKRTPIGKKNGMLKDYEVQQLAAPLLTFLSKGMERAIDDVILGNVVGPGGNV
ARLSALEAGLSHHIPGVTIDRQCGAGLEAIRTACHFIQGGAGKCYIAGGVESTSMSPFQN
RARFSPETIGDPNMGVAAEYVAESYNITREMQDEYACLSYKRTLQALAKGYIHEEILSFN
GLLDESIKPEMNYERIIKRTKPAFLHNGTVTAGNSCGVNDGACTVLVMEEGQARKLGYKP
VLRFVRSVVVGVDPNLPGTGPIFALNKLLDEMNMKVEDIDYFEINEAFASKVVACAKELQ
IPYEKLNVNGGAIALGHPYGASGAMLITRLFYQAKRERMKYGIATLGIGGGIGLALLFEK
VED
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagcagttattgtagaagcgaaaaggacacctattggtaagaagaatgggatg
ttaaaagactatgaagttcagcaattagcagcaccgcttcttacatttttaagtaaagga
atggagagagcgatagacgatgtcatattagggaatgttgttgggccaggagggaatgtt
gcgagattatctgctttagaagcagggcttagtcatcatattccgggtgtaacgattgac
cggcaatgtggtgccggattggaagcgattcgcaccgcgtgtcatttcattcaaggcggg
gccggtaagtgttatatcgccggaggagtagagagtacaagtatgtcaccttttcaaaat
agagcacgattttcaccagaaacaataggcgatcctaatatgggagtagcggctgaatat
gttgcagaaagttataacatcacgagagaaatgcaagacgagtatgcatgcctcagttat
aaacgaacactgcaagcattagcaaaaggatatatacatgaggaaatattgtcttttaat
ggattgctagatgaatccattaagccagaaatgaattatgaacgaatcattaaaagaaca
aaacctgcatttttacacaatggtacagtaacggcaggtaattcgtgcggtgtaaatgat
ggagcatgtaccgttcttgtaatggaagagggacaagcccgaaaattaggatacaagcct
gtacttcgtttcgttcgtagtgttgtagttggagtggatcccaaccttccggggactggt
ccgatatttgcgttgaacaaattattagacgaaatgaatatgaaagtagaggacatcgat
tattttgaaataaacgaagcgttcgcttcaaaagttgtagcttgtgcaaaggaattacaa
attccgtatgaaaaattaaatgtaaatggtggtgcaattgcgctcggtcatccgtacggt
gcatctggggctatgcttataacgcgcttgttttatcaggcgaaacgagagcgtatgaaa
tacggaatcgcgacgttaggaatagggggcgggataggtcttgcactattatttgagaaa
gtagaagactag

DBGET integrated database retrieval system