KEGG   Bacillus cereus E33L: BCE33L5044Help
Entry
BCE33L5044        CDS       T00198                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase (acetoacetyl-CoA thiolase)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcz  Bacillus cereus E33L
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCE33L5044 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    BCE33L5044 (atoB)
   00640 Propanoate metabolism
    BCE33L5044 (atoB)
   00650 Butanoate metabolism
    BCE33L5044 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    BCE33L5044 (atoB)
   00072 Synthesis and degradation of ketone bodies
    BCE33L5044 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCE33L5044 (atoB)
   00310 Lysine degradation
    BCE33L5044 (atoB)
   00380 Tryptophan metabolism
    BCE33L5044 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCE33L5044 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCE33L5044 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCE33L5044 (atoB)
Enzymes [BR:bcz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCE33L5044 (atoB)
Exosome [BR:bcz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCE33L5044 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5142409..5143590)
Genome map
AA seq 393 aa AA seqDB search
MSKTVILSAARTPVGKFGGSLKDVKATELGGIAIKAALERANVSASDVEEVIFGTVIQGG
QGQIPSRQAARAAGIPWEVQTETVNKVCASGLRAVTLADQIIRTGDQSLIVAGGMESMSN
SPYILRGARWGYRMGNNEVIDLNVADGLTCAFSGIHMGVYGGEVAKEDGISREAQDEWAY
RSHQRAVSAHKEGRFEEEIVPVTIPQRKGDPIVVAKDEAPREDTTIEKLAKLKPVFDKTA
TVTAGNAPGLNDGGAALVLMSEDRAKQEGRKPLATILAHTAIAVESKDFPRTPGYAINAL
LEKTGKKIEDIDLFEINEAFAAVAIASTEIAGIDPEKLNVNGGAVAMGHPIGASGARIIV
TLIHALKQRGGGIGIASICSGGGQGDAVMIEVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacagttattttaagtgctgcaagaacaccggttggaaaattcggaggatct
ttaaaagatgtaaaagcaacagaacttggaggaattgcaattaaagcggcgcttgaaaga
gcgaatgtttcagctagtgatgttgaggaagttatattcggaacggttattcaaggtggg
cagggacaaattccatcgcgccaagcggcacgggctgctggaatcccttgggaggtgcag
acggaaacagtgaataaagtttgtgcatcggggcttcgtgcagttacgttagccgatcaa
attattcgtactggcgatcaatcattgattgtagctggcggtatggaatcgatgagtaac
agtccttatattttacgaggagcaagatggggatacagaatgggtaacaacgaagtcatt
gatttaaacgttgctgacggtttaacatgcgcattttcaggtatacacatgggtgtttat
ggcggagaagttgcgaaggaagatgggatttcccgcgaagcgcaagatgaatgggcatat
cgtagccatcagcgtgcggtttcagcacataaagaaggacgttttgaagaggaaattgtg
ccagtaacgattccacaaagaaaaggggatcctattgtcgttgcaaaggatgaggcgccg
cgtgaagatacaacaattgaaaaactagcaaaattaaaacctgtatttgataagacagcg
acggtaacagctggtaatgcaccagggctaaacgatggtggcgctgcacttgtattaatg
agcgaagacagagcgaagcaagaaggaagaaagccgttagcgacaattttggcacataca
gcaattgcagtggagtctaaagattttccgaggacgccaggttatgcaattaacgcattg
cttgaaaaaacaggaaagaaaattgaagacatcgatttatttgagattaatgaagcattt
gcagcggtagcaattgcaagtacagaaatcgcaggaattgacccagaaaaattgaatgta
aatggcggcgcagtggcgatgggacatccgattggagcaagcggagcgcgcattatcgtt
acattaatccatgcacttaagcaacgcggcggtggaattggaattgcttcgatttgtagt
ggtggcggtcaaggcgatgcagtgatgattgaagttcactaa

DBGET integrated database retrieval system