KEGG   Bacillus cereus ZK: BCZK0021Help
Entry
BCZK0021          CDS       T00198                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bcz  Bacillus cereus ZK
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCZK0021 (recR)
DNA repair and recombination proteins [BR:bcz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BCZK0021 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
27572..28168
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVC
GHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMEGIGPE
DINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaaccaatatcaaaactaattgatagttttatgaaattgccaggaatc
ggaccgaaaacagcggttcgattggcatttttcgtattagatatgaaagaagatgatgtg
ttaggttttgcaaaagcacttgtaaatgcaaagcgagacttagcgtattgttctgtatgc
gggcatattactgaccgtgacccttgttatatttgtaacgattcacatcgagatcaatca
gttgtttgtgtcgtacaagaaccgaaagatgtaatcgcgatggaaaagatgaaagagtat
caaggtgtatatcatgtgttacgtggtgctatctctccaatggagggaattggaccagaa
gacattaatatcccgcagcttttaaagcgactgcacgatgaaacggtacaagaagtaata
ttagcaacaaatcctaatattgaaggggaagctacagcgatgtatatatcccgcctctta
aagccgacaggtattaaagtaactcgtattgcacacggtctgccagttggtggagattta
gaatatgcagatgaagtgacactgtcgaaagcgttagaaggtcgtagagaagtataa

DBGET integrated database retrieval system