KEGG   Bacillus cereus ZK: BCZK0067Help
Entry
BCZK0067          CDS       T00198                                 

Gene name
sul
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bcz  Bacillus cereus ZK
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCZK0067 (sul)
Enzymes [BR:bcz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BCZK0067 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77504..78346
Genome map
AA seq 280 aa AA seqDB search
MCSLKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGA
HIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAH
IINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVR
DENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEG
TGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKGVK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagtttgaagtgggattatgatttgcgctgcggcgaatatacattgaacttaaat
gaaaaaacgttaattatggggattttaaatgtaacaccagattcgttttctgatggtggg
agttataatgaggtagatgctgcagtgcgccatgcgaaagaaatgcgagatgaaggtgct
catattattgatattggtggcgaatctactcgtccgggttttgctaaagtatcggtggaa
gaagaaataaaacgagttgttccgatgattcaggctgtttcaaaagaggtaaaattgcct
atttctatcgacacgtataaagctgaagttgcaaaacaagcaattgaagctggtgctcat
attattaatgatatttggggagcgaaggcagaaccaaaaatcgctgaagttgcagctcat
tacgatgtacctattatcttaatgcacaatcgcgataacatgaattatcgtaatttaatg
gctgatatgattgctgacttatatgacagtattaaaattgctaaagatgctggtgtgcga
gatgagaatatcattttagacccgggtattggttttgctaaaacacctgaacaaaattta
gaagcgatgcgtaatttagaacagttaaacgtactaggttatccagttctcttaggtact
tcaagaaagtcctttattgggcatgtactagatttaccggtagaagaacgtcttgaggga
acgggagctaccgtttgtcttggtattgaaaaggggtgtgagtttgttcgtgttcatgat
gtgaaggaaatgtcgcgtatggctaagatgatggatgcgatgattggtaagggggtaaag
taa

DBGET integrated database retrieval system