KEGG   Bacillus cereus ZK: BCZK0168Help
Entry
BCZK0168          CDS       T00198                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcz  Bacillus cereus ZK
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCZK0168
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCZK0168
  Lipid metabolism
   00071 Fatty acid degradation
    BCZK0168
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCZK0168
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCZK0168
   00626 Naphthalene degradation
    BCZK0168
Enzymes [BR:bcz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCZK0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(177185..178093)
Genome map
AA seq 302 aa AA seqDB search
MKAIICTQYGPPNVLQLQNIEKPIPKKNEVLVKIHATSVSTGDCRIRRFNSPLLFWIPMR
LILGLRKPRNPILGVELAGEIEDIGTDVTQFKKGDQIFALTELNLGGYAEYTCVHESGLI
TLKPTNVTYEEAAVIPFGGTSALHFLRKGRIKKGQQVLIYGASGSVGTAAIQLAKYFGAT
VTAVCSNSNFELVQSLGADKVIDYTKEDFTKRRERYDIIFDAVGKYKKSLCTNTLTPNGK
YVSVNGMMAKVSKEDMILLKKLTETEHLKPVIDRIYRLEEIAEAHMYVEKGHKKGNVSIT
LK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgatcatttgcacacagtatggaccacctaacgttcttcagcttcaaaatata
gagaaacctatacctaaaaagaacgaagtattagttaaaattcacgcaacaagtgtatcg
actggagattgtagaatacgcagatttaatagccctctattattttggattcctatgcga
cttatattaggacttagaaaaccgagaaaccctatacttggcgtagaattagcaggagag
atagaggatatcgggacagatgtaactcaatttaaaaaaggggatcaaatttttgcatta
acagaactcaatcttggtggttatgccgaatacacatgcgtgcatgaaagtggattaata
acattaaaacctaccaatgtaacgtatgaagaagcggcagttattccttttggtggaact
tcagcgttgcactttctgagaaaaggccggataaaaaaagggcaacaagttctcatatat
ggtgcctctggatcagtaggaacagctgccatacaactcgctaaatattttggtgcgacc
gttacagctgtttgtagtaattcaaattttgaactcgtgcaatctttaggagcggataaa
gtaattgattatacgaaagaagattttactaagcggcgcgagcgttacgatattatattt
gatgctgttgggaaatataaaaaatccctttgtacaaatacattaacacccaatggaaaa
tatgtatctgtgaatggaatgatggcaaaagtaagtaaagaggatatgattctactaaaa
aaactaactgaaacagaacatttaaaacctgttattgatagaatttaccgattagaagaa
attgccgaagctcatatgtatgtggaaaaagggcataaaaaaggaaacgtttcgattacc
ttaaaataa

DBGET integrated database retrieval system