KEGG   Bacillus cereus ZK: BCZK0249Help
Entry
BCZK0249          CDS       T00198                                 

Gene name
frnE
Definition
protein disulfide isomerase (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
bcz  Bacillus cereus ZK
Brite
Enzymes [BR:bcz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BCZK0249 (frnE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
278155..278886
Genome map
AA seq 243 aa AA seqDB search
MKIEVWSDFVCPFCYIGKRRLEVALEQFPHKKDVEVEFKSFELDQNAPIYSGTSINEVLA
SKYGISIEEAKRNNVQLGNHAASMGLSFNFDEMKPTNTFDAHRLAKFAKDQGKEKEITEK
LLLAYFTESRNLSDVDTLATIAEASGLDKQEALKVINDKSAYANDVRVDEAIAQQYQISG
VPYFIINQKYAISGAQPLETFVGALQQVWEEENPVPKLQELSSEGGSDMSCTDESCSVPS
KEQ
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgaagtatggtcagattttgtatgcccattttgctacattgggaaacgtagg
ttagaagtggctttagaacaatttcctcataagaaggatgttgaagttgagtttaaaagt
tttgaattagaccaaaatgctccaatctattctggaacaagtattaatgaagtacttgca
tcaaagtatgggattagtattgaagaagcgaaacgtaataatgtgcagctaggcaatcat
gcggctagcatgggtttaagttttaattttgatgagatgaagccgacgaacacttttgat
gcgcatcgtcttgcgaaatttgcaaaggatcaagggaaagaaaaagagattacggaaaaa
ctacttttggcatatttcactgaatcaagaaatttaagtgatgtggatacgctcgctact
atagctgaagcttcaggtttagataaacaagaagctttaaaggttattaatgataaaagt
gcatatgcaaatgatgttagagttgatgaagcaatcgctcagcaatatcaaatttcagga
gtaccttattttattattaatcaaaagtatgctatttcaggtgcgcaaccacttgaaact
tttgttggtgcacttcagcaagtgtgggaagaagagaatcctgtaccgaagttacaagag
ctttcttcagaaggtggaagcgatatgtcttgtacagatgaaagctgttcggtaccttca
aaagaacaatag

DBGET integrated database retrieval system