KEGG   Bacillus cereus ZK: BCZK1133Help
Entry
BCZK1133          CDS       T00198                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bcz  Bacillus cereus ZK
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bcz01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bcz00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1237338..1238099
Genome map
AA seq 253 aa AA seqDB search
MGTILDKIVDQKKKEVAALYETYTPVKEKRKTRSLVKALEQFTVIAEVKRASPSKGDINL
HVDVRKQVKTYEECGAGAVSVLTDGQFFKGSFYDLQTAREESSIPLLCKDFIIDKIQIDR
AYEAGADIILLIVAALTKEKLKELYSYVLEKGLEAIVEVHDEQELEIAIQLNPHVIGINN
RNLKTFEVDLSQTEKLGKRLNEEKLLWISESGVHSKEDMIRVKRAGAKGVLVGEALMTSS
SIHTFFEDCKVNI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggggacgattttagacaaaattgtagatcaaaagaaaaaggaagttgcggcattatat
gaaacatatacaccagtaaaagaaaaaagaaaaacgcgctcacttgtaaaggctctagag
caatttactgtcattgcagaagtaaagcgagcatcaccatcaaaaggagatattaattta
catgttgatgtacgaaaacaagtgaagacatatgaagaatgcggcgctggtgcagtttct
gttttaacagacggtcaattttttaaaggatcattttatgatttacaaacggcaagagaa
gaaagtagcattccgcttttatgtaaagatttcataatcgataagattcaaattgataga
gcgtatgaagctggtgcagatattattttactaattgtagcggcgttaacgaaagagaaa
ttaaaagagttgtatagctacgtactagaaaaaggattagaagcgattgttgaagttcat
gatgaacaggaattagaaattgcaattcaattaaatccgcacgttatcggtattaacaac
cgtaatttaaaaacattcgaagtcgatttaagtcaaacagaaaagcttggaaaacgatta
aatgaggagaaattactttggattagtgagagcggggttcattcaaaagaagacatgatc
cgcgttaaacgagccggggcaaaaggtgtactagttggagaagcgcttatgacatcgtct
tctattcataccttttttgaagattgtaaggtgaacatatga

DBGET integrated database retrieval system