KEGG   Bacillus cereus ZK: BCZK1571Help
Entry
BCZK1571          CDS       T00198                                 

Gene name
gpm
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcz  Bacillus cereus ZK
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCZK1571 (gpm)
   01230 Biosynthesis of amino acids
    BCZK1571 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCZK1571 (gpm)
  Energy metabolism
   00680 Methane metabolism
    BCZK1571 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCZK1571 (gpm)
Enzymes [BR:bcz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCZK1571 (gpm)
Exosome [BR:bcz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCZK1571 (gpm)
  Exosomal proteins of melanoma cells
   BCZK1571 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1653705..1654280
Genome map
AA seq 191 aa AA seqDB search
MTIIYFVRHAHSTYTKEERERPLSEKGHLDAENVTHLLKDKHIDVVISSPYKRAIQTVQG
IANTYHVSIEIEEDLRERLLSSEPVADFNDAIENVWEDWSFAYEGGESNDVAQRRAVICM
QNILKKYEDKNIVIGTHGNIMVLLMNYFDSKYDFQFWKTLHMPDVYKLTFDNNRFISAER
IQSTDYQINNL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacgataatatatttcgttcgccatgcccattctacatatacaaaagaagagcgggag
cgtcctttatctgaaaaagggcacttggatgcagagaatgtaacacacttattaaaagat
aaacatattgatgtagtgatttctagtccgtacaaaagagcaattcaaactgtacaagga
attgcgaatacatatcatgtatcaatagaaatagaagaagatttacgagaaaggttatta
agttcagaaccagtagcagattttaatgatgctatcgagaatgtgtgggaagattggagt
tttgcatacgaaggcggagaatcgaacgatgtagcgcaaaggcgtgctgtaatatgtatg
caaaatatattaaaaaaatatgaagataagaatattgtaataggaactcatgggaatatt
atggtattacttatgaattattttgattcaaaatatgattttcagttttggaaaaccctt
catatgcctgacgtgtataaattaacttttgataataatcgttttatttctgctgaaaga
atacagtctacagattatcagataaataatttgtaa

DBGET integrated database retrieval system