KEGG   Bacillus cereus ZK: BCZK1643Help
Entry
BCZK1643          CDS       T00198                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bcz  Bacillus cereus ZK
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCZK1643 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCZK1643 (glcK)
   00052 Galactose metabolism
    BCZK1643 (glcK)
   00500 Starch and sucrose metabolism
    BCZK1643 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BCZK1643 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCZK1643 (glcK)
   00524 Butirosin and neomycin biosynthesis
    BCZK1643 (glcK)
Enzymes [BR:bcz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BCZK1643 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1730994..1731935
Genome map
AA seq 313 aa AA seqDB search
MGKYVACFDIGGTFIKYAMIDEQGMVHEQGKITTPVQNQKKEILYRICEVIYEFEKSYKI
HSVGVSSCGIIDNIKGEVLYSANILGYSGTKIADYIYSETGYVASIENDVRSACLGEMWK
GVGQGKEHIVLITLGTGIGSGIIINGKMLQGVKGLAGELGHMIIVHNGEKCSCGGEGCYE
RYASTSALIRQYKEASKIQGLEIGTITGEEIIERMYRGERLAKDVYEQFLQYVVAGLVNI
TYIFNPELIIIGGGITEQGEPFLKQIQERFHDKIMDIYQNKVEIALASLHNDAGVYGACY
VALNQCEEKSMNI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggggaagtacgttgcttgttttgatattggaggaacttttataaaatatgcaatgatt
gatgaacaaggaatggtacatgaacaagggaaaataacaacaccagtacaaaatcaaaag
aaagaaattttgtatcgcatttgtgaagtaatatatgagtttgaaaagagctataaaatt
cattctgtaggtgtatcatcgtgtgggattattgataatatcaagggggaagttctgtat
tctgccaatattttgggatatagcggtacaaaaatagcagattacatttatagtgagaca
gggtatgtggcgagtattgaaaatgatgttcgttcagcttgtctcggtgaaatgtggaaa
ggagtagggcaggggaaagaacatattgttttaatcacacttggaaccggaattggtagt
ggaatcattataaatggcaaaatgcttcagggagtgaaaggattagcaggagagcttggt
catatgataattgttcataatggagaaaaatgtagttgtggcggagagggatgttatgag
agatatgcatcgacttcggcattgattcgtcagtataaagaagcatcaaaaattcaaggg
ctagagataggtacaatcacaggtgaagaaattatagaacgtatgtacagaggagaacga
ttggcaaaggatgtatatgaacagtttctacagtatgttgttgctggtttagtaaatatt
acttatatatttaaccccgaattaattattattgggggaggtattacagagcaaggtgaa
ccatttttgaaacaaattcaagaaaggttccatgacaaaataatggatatctatcaaaat
aaggtggaaatcgctttagcatcattacataatgatgctggtgtatatggagcttgttat
gtagcgttgaatcaatgtgaggaaaagtcaatgaatatataa

DBGET integrated database retrieval system