KEGG   Bacillus cereus ZK: BCZK1783Help
Entry
BCZK1783          CDS       T00198                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bcz  Bacillus cereus ZK
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCZK1783 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCZK1783 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BCZK1783 (thrC)
Enzymes [BR:bcz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BCZK1783 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1908379..1909437
Genome map
AA seq 352 aa AA seqDB search
MYKGLLNQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQRAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIDEPETIATAIRI
GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKTEGVFAEPGSNASLAGVMKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISSNTLDIASVSNNIEQIKEHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggactattaaaccaatatgcttcttatttaccggtaaatgaaaacacacca
gatgtgagcttaatggaaggaaatacaccccttattccgttattaaacatatcaaaacaa
ttagggattcagttatacgggaagtatgaaggagcgaatccgacaggttcttttaaagat
cgaggcatggtaatggctgttgcgaaggcgaaagaagaaggttcggaggcaatcatttgt
gcatcgacaggtaatacatcagcatcggctgccgcatacgcggcacgccttggaatgaaa
tgtattatcgtaataccggaaggaaagattgcacatggaaaattagcacaagcagttgcg
tatggtgctgaaatcatttcaatagaaggaaattttgatgatgcattaaaggctgtaaga
aatatcgctgcggaagagccgattacgttagtaaactcagtgaatccttatcgaattgaa
gggcaaaaaacagcagcgtttgaaatttgtgatcagttgcaacgtgcaccagatgttcta
gcgatccctgttgggaatgccggaaatattacagcgtactggaaaggtttctgtgaatat
gagaaagaaaaaggttataaaaagccaagaattcacggatttgaagcggaaggagcagct
gcaattgtaaaagggcatgtaattgacgagccagaaacaattgcaactgcgattcgcatc
ggtaacccagcaagttggtcatatgcggtagaggctgctgagcaatctcacggcgaaata
gatatggtatcagatgaagagattttacatgcgtatagattattagcaaaaacggagggg
gtttttgctgagccaggatcaaatgcttcattagcgggtgtaatgaaacatgttcaatct
ggaaaaatcaaaaagggagaaacagttgttgcagttttaactggaaatggcttgaaagat
cctgatatcgcaatttcttctaatacattagatattgcaagtgtctcaaataatatagaa
caaattaaagagcatattaaaggggtgattatgtcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system