KEGG   Bacillus cereus ZK: BCZK1881Help
Entry
BCZK1881          CDS       T00198                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcz  Bacillus cereus ZK
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCZK1881
   01230 Biosynthesis of amino acids
    BCZK1881
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCZK1881
  Energy metabolism
   00680 Methane metabolism
    BCZK1881
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCZK1881
Enzymes [BR:bcz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCZK1881
Exosome [BR:bcz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCZK1881
  Exosomal proteins of melanoma cells
   BCZK1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2002586..2003176
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILNVHEGRADFELTEKGREQVQRLVKKVKADFPPDFIWASTLKRAR
ETGETLAEGIGCPIQLEEELMEFNNGVQAGLSFEEAQKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVTENTYDRIAIVAHGGVINSLLRAFFKMPISMDYYFKMGDTGISLLEMDGE
QKTVHFINDTNHLDGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgccacggagaatcagaagctgatattttaaacgtacatgaa
ggacgagctgactttgaattaacagaaaagggaagagagcaggtgcaaagacttgtaaag
aaagtgaaagcagattttccaccagatttcatttgggcaagtacattaaaacgtgctcgt
gaaactggtgaaacgttagcagagggaattggatgtccaattcaattagaagaggaatta
atggagttcaataatggagtgcaagcaggtctttcatttgaagaagctcagaaatatccc
gagccaaagtttcttcatgatcgttttgaaaacggggaatcatttattgaatttagaatg
agaatagaaggcatcttttctaaaatcgtgacggagaatacatatgaccgaattgcaatt
gttgcacacggtggtgtaataaatagtctattacgtgcgtttttcaaaatgccaatttca
atggactattattttaaaatgggagatacgggaataagcttacttgaaatggatggcgaa
caaaaaacggtacattttattaatgatacaaatcatttggacgggatgtaa

DBGET integrated database retrieval system