KEGG   Bacillus cereus ZK: BCZK1947Help
Entry
BCZK1947          CDS       T00198                                 

Definition
bifunctional uroporphyrinogen-III methyltransferase/uroporphyrinogen-III synthase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bcz  Bacillus cereus ZK
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bcz00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2059290..2060714)
Genome map
AA seq 474 aa AA seqDB search
MNGYVYLVGAGPGDEGLITKKAIECLKRADIVLYDRLLNPFFLSYTKQTCELMYCGKMPK
NHIMRQEMINAHLLQFAKEGKIVVRLKGGDPSIFGRVGEEAETLAAANIPYEIVPGITSS
IAASSYAGIPLTHRNYSNSVTLLTGHAKGPLTDHGKYNSSHNSDTIAYYMGIKNLPTICE
NLRQAGKKEDTPVAVIEWGTTGKQRVVTGTLSTIVSIVKNENISNPSMTIVGDVVSLRDQ
IAWKERKPLHGKKVLFTSATNKTSVMKQRLQEAGAEIYQIPTFKKEEYTLTLEQINEIFN
VDRLVFCSAESVEILMQSCSKYQKDIRSLQAELQHMNVATQEKLMQYGLLSKEAKFSSDT
TVYLGRNINRIAFIQEKIGAGSYMMTHKYTIDHRFDEVHSRMLSEFLWDSIVFEGRASID
TFLAEVKRLGFIDIVTLPFSYTDVPTLHYANKVGFHNVDHQLQETLMKKDMVRQ
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaacggatatgtatatttagttggtgcaggacctggtgatgaagggcttattacaaag
aaagcgatagagtgtttaaaacgtgcagatattgttttatatgaccgtttactaaaccct
ttctttcttagctatacaaaacaaacatgtgaacttatgtattgcggaaaaatgccaaag
aatcatattatgcgacaagaaatgattaacgcacaccttcttcaatttgcaaaagaggga
aaaattgttgtccgattaaaaggcggagatccatctatttttggccgtgttggtgaagaa
gcagaaactttagcagcagcaaatattccatatgaaattgtaccaggcattacatctagc
atcgccgctagtagctatgcaggtatcccccttacccaccgtaactacagtaatagcgtt
actttactaaccggacatgcaaaaggtcctttaaccgatcatggaaaatataattcatct
cacaatagcgatacgattgcctactacatgggtataaaaaacttacctacaatttgcgaa
aacttacgacaagcaggaaagaaagaagatacgccagtagcagtcattgaatggggtaca
actggtaaacagcgcgttgtcacagggacactatctaccattgtttctatcgtcaaaaat
gaaaatatttctaacccttctatgacaattgttggtgatgtcgtttccttacgagatcaa
atcgcttggaaagaacgtaaaccattacacggtaaaaaagttttatttacatccgcaaca
aataaaacaagtgtaatgaagcaaaggttacaagaagctggtgcagaaatatatcaaatt
ccaactttcaaaaaggaagaatatacattaacacttgaacaaatcaatgaaatttttaac
gttgatcgccttgttttttgttcagctgaaagtgtagaaattttgatgcaatcatgtagt
aaataccagaaagatattcgttccttacaggcagagctgcaacatatgaacgttgccact
caagaaaaacttatgcaatatggcctactaagtaaagaagcaaagttctcttccgataca
actgtttatttaggcagaaatattaatcggattgcttttattcaagagaaaattggtgcc
ggctcctatatgatgactcataagtatacaattgatcatcgtttcgatgaagtccattct
cgtatgctttcagaattcttatgggatagcattgtatttgaaggacgcgcttctattgat
acgtttctagcagaagtaaaacgtcttggctttatcgatattgttactctcccattctcg
tataccgacgttccaactttacactatgcaaataaagtcgggtttcataacgtagatcat
caattacaagaaactcttatgaaaaaagatatggtaagacaatga

DBGET integrated database retrieval system