KEGG   Bacillus cereus ZK: BCZK2005Help
Entry
BCZK2005          CDS       T00198                                 

Gene name
gbsB
Definition
iron-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcz  Bacillus cereus ZK
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCZK2005 (gbsB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCZK2005 (gbsB)
  Lipid metabolism
   00071 Fatty acid degradation
    BCZK2005 (gbsB)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCZK2005 (gbsB)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCZK2005 (gbsB)
   00626 Naphthalene degradation
    BCZK2005 (gbsB)
Enzymes [BR:bcz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCZK2005 (gbsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
2128011..2129213
Genome map
AA seq 400 aa AA seqDB search
MQEVAEFRMPKSVLYGRNSLEKLGEQSKKFGKRAFIVTDTIMEDLGYVERCIQQLNTKGI
TVITYNKVNAEPTNIHVLEALTICKEGKCDFIIGLGGGSCIDAAKAVTVLYTNGGEVEDY
VQKDSEIDNDPLPLIAIPTTSGTGSEVTSVAVITNKRTDVKMMMKHPSFTPQVAIIDPIL
TRSVPPHITAATGIDALCHAVEAYISKVSQSLTDVLALSAIESIMKYLRIAYEDGENMEA
REAMMIASLQAGIAFSNASVTLVHGMSRPVGALFHVPHGISNAILLPTVLEYTKGSAVKR
LAEIGRCLNKDLYSYCDEEVADYTLGEIKKLCFDLRIPNLKEYGIGEVEFEKAISKMASD
AIESGSPANNPRVPSYDEIKQLYRECFHYKYEDSVKTLGD
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagaagttgctgagtttcgtatgccgaagtctgtattatatggaagaaattctctt
gaaaagctgggggaacaatctaagaaattcgggaaaagagcgtttatagttacggataca
attatggaggatttaggatatgttgagaggtgtatacaacaattaaatacgaaaggtata
actgttattacatataataaagtaaatgctgagcctacaaatatacacgtgttagaggcg
ttaactatttgtaaagaaggaaagtgtgattttataatcggtcttggtggtggaagttgt
attgatgcagcaaaagcagttactgtgttatatacaaatggcggagaagtggaagattat
gtccaaaaggatagtgaaatagacaatgatccgctaccacttattgcaatcccaacaact
tctggaactggatcggaagtaacaagtgtagcagtaattacgaataaacgaacagatgta
aaaatgatgatgaagcatccgagttttaccccgcaagtagcgattattgacccgatttta
acacgttcggtaccacctcacattacagcagcaacagggatcgatgcattatgtcatgca
gtcgaagcatatatttctaaagtttcacaatcacttacagatgtactcgctctttcagca
attgaaagtattatgaaatatttacgtattgcttatgaagatggagagaatatggaggca
agagaagcgatgatgattgcttccttacaagctggaattgcattttccaatgcatctgtt
acattagttcatggcatgtcgagaccagtaggagcattatttcatgtaccacatggtata
tcgaatgcaatactattacctacagttttagaatatacaaaaggtagtgcggtaaaaaga
ctagcggaaattggccgctgtttaaataaagatttgtattcctattgtgatgaagaagta
gccgactacacgctgggggaaataaaaaaactttgttttgatcttcgtattccaaattta
aaagaatacggaattggtgaagttgagtttgaaaaagctatttctaaaatggcgtcagat
gcaattgaaagtggaagtccagcgaataacccacgtgtgccatcatatgatgaaattaaa
cagttgtatcgagaatgttttcattataaatatgaagattcagtaaaaacattaggggat
taa

DBGET integrated database retrieval system