KEGG   Bacillus cereus ZK: BCZK2234Help
Entry
BCZK2234          CDS       T00198                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcz  Bacillus cereus ZK
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCZK2234 (gpmA)
   01230 Biosynthesis of amino acids
    BCZK2234 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCZK2234 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BCZK2234 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCZK2234 (gpmA)
Enzymes [BR:bcz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCZK2234 (gpmA)
Exosome [BR:bcz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCZK2234 (gpmA)
  Exosomal proteins of melanoma cells
   BCZK2234 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2363558..2364295
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMNLAWVPVHKSWKLNERHYGALQGLNKDETAQKYGEEQVHIWRRSIDVR
PPALTEDDPRYEMNDPRYKALKKGEFPLTECLVDTEKRVLDYWHSEIAPKLKNGNKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDENLRPIRHYYLSMDGEVPEGEIP
KHISF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacagagtttatggaatcttgaaaatcgtttt
actggatggacagatgtagatttatcagagaatggattaagtgaagcgagagaggcagga
gcgatattaaagaaaaatggatatacttttgatgtagcttatacatctgtattaaaacga
gcaattcggacgttatggattgtacttcatgaaatgaatcttgcctgggtaccagtacat
aaatcttggaagctaaatgaaagacattatggtgcattgcaaggtttgaataaagatgaa
accgcgcaaaaatatggtgaggagcaagttcatatttggagaagaagtattgatgtaaga
ccacctgctcttactgaggatgatcccaggtatgaaatgaatgatccaagatataaagca
ctgaaaaaaggtgagtttccattgacagaatgtttagtggatacggagaaaagagtactt
gattattggcattcagaaattgcgccgaaattaaagaatggtaacaaagtaatcatttca
tcacatggtaacacaattcgctcgctagtaaaatatttagataatctttcaagcgatggt
gttgtttcactaaatattccaacgagtataccgctcgtttatgaattagacgaaaattta
cgtccgattcgccattattacttaagtatggatggagaagtacctgaaggggaaattccg
aaacatatttctttttaa

DBGET integrated database retrieval system