KEGG   Bacillus cereus ZK: BCZK2421Help
Entry
BCZK2421          CDS       T00198                                 

Gene name
choA
Definition
chitosanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bcz  Bacillus cereus ZK
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BCZK2421 (choA)
Enzymes [BR:bcz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BCZK2421 (choA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2560393..2561754
Genome map
AA seq 453 aa AA seqDB search
MNGKRNIFTCISIVGIGLASFSNSSFAASVTDNSIQNSIPVVNQQVAAAKEMKPFPQQVN
YAGVIKPNHVTQESLNASVRSYYDNWKKKYLKNDLSSLPGGYYVKGEITGDADGFKPLGT
SEGQGYGMIITVLMAGYDSNAQKIYDGLFKTARTFKSSQNPNLMGWVVADSKKAQGHFDS
ATDGDLDIAYSLLLAHKQWGSNGAVNYLKEAQDMITKGIKASNVTNNSRLNLGDWDSKSS
LDTRPSDWMMSHLRAFYEFTGDKTWLTVINNLYDVYTQFSNKYSPNTGLISDFVVKNPPQ
PAPKDFLNESEYTNAYYYNASRVPLRIVMDYAMYGEKRSKVISDKVSSWIQNKTNGNPSK
IVDGYQLNGSNIGSYPTAVFVSPFIAASITNSNNQKWVNSGWDWMKNKRESYFSDSYNLL
TMLFITGNWWKPIPDNKKAQNQINDVIYEGYDN
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaaaaagaaatatttttacatgtatttctattgtaggaatcggactagctagt
ttttctaattctagtttcgcagcaagtgtaacggacaattcaatacaaaattctattcct
gtagttaatcaacaagtagcagctgcaaaggaaatgaaaccatttccccagcaagttaat
tatgcaggtgttataaaaccgaatcatgttacacaagaaagtttaaatgcttctgtaaga
agttactacgataattggaaaaagaaatatttgaaaaatgatttatcttctttacctggt
ggttattacgtaaaaggagagattacaggtgatgcggatgggtttaagccacttggaact
tcagaaggtcaagggtatgggatgataattacagtattaatggctggttatgattcgaat
gctcaaaaaatctatgacggtttatttaaaacagcaagaacttttaaaagctctcaaaat
cctaatttaatgggatgggttgtcgcagatagtaaaaaagcacaaggtcattttgattct
gctactgatggggatttagatattgcgtattctcttcttcttgctcacaaacagtgggga
tcaaatggagcagttaattatttaaaagaagcacaagacatgattacaaaaggtattaaa
gctagtaatgttacaaataatagccgactaaatttaggagattgggattctaaaagttca
cttgatacgagaccatctgattggatgatgtcacaccttagagcattttatgaatttaca
ggtgataaaacttggctcactgttattaataatttgtacgatgtttatacgcaatttagt
aataagtactctccaaatacaggacttatttcagattttgttgtaaaaaacccaccacaa
cccgcacctaaagacttcttaaatgagtcagaatatacaaatgcatattattataatgct
agtcgagtacctttaagaattgtaatggactatgcgatgtacggcgagaagcgaagtaaa
gtcatttctgataaagtatcttcatggattcaaaataaaacgaatggaaatccttctaaa
attgtggatggttatcaattaaacggatccaatattggtagttatccaactgctgtattc
gtttcgccatttattgctgcaagtataacaaatagcaataatcaaaagtgggtaaatagc
ggttgggattggatgaagaataagagagaaagctattttagtgatagttataatttatta
actatgttatttattacaggaaattggtggaaacctatacctgataataaaaaggcacaa
aatcaaataaatgatgtaatttatgaaggatacgataattaa

DBGET integrated database retrieval system