KEGG   Bacillus cereus ZK: BCZK2921Help
Entry
BCZK2921          CDS       T00198                                 

Definition
NADPH-cytochrome P450 reductase (EC:1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bcz  Bacillus cereus ZK
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bcz00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bcz00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bcz00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(3049859..3053056)
Genome map
AA seq 1065 aa AA seqDB search
MDKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKIAEEYGPIFRMQTLSDAIIVVSGHEL
VAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETDEPNWKKAHNILMPTFSQRAMKDYHA
MMVDIAVQLVQKWARLNPNENVDVPGDMTRLTLDTIGLCGFNYRFNSFYRETPHPFITSM
TRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSGNQEENDLLSR
MLNVQDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFTIYFLLKNPDKLKKAYEEVDR
VLTDPTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISV
LIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVMG
MLLQHFEFIDYEDYQLGVKQTLTLKPGDFKIRIVPRNQTISHNTVLAPTEEKLKNHEIKQ
KVQKIPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVAALNDRIGSLPKE
GAVLIVTSSYNGKPPSNAGQFVQWLEELKGDELKGVQYAVFGCGDHNWASTYQRIPRYID
EQMAQKGATRFSTRGEADASGDFEEQLEQWKESMWSDAMKAFGLELNKNIEKERSTLSLQ
FVSRLGGSPLARTYEAVYASILENRELQSSSSERSTRHIEISLPEGATYKEGDHLGVLPI
NSEKNVNRILKRFGLNGKDQVILSASGRSVNHIPLDSPVRLYDLLSYSVEVQEAATRAQI
REMVTFTACPPHKKELESLLEDGVYHEQILKKRISMLDLLEKYEACEIRFERFLELLPAL
KPRYYSISSSPLVAQNRLSITVGVVNAPAWSGEGTYEGVASNYLAQLHNKDEIICFIRTP
QSNFQLPENPETPIIMVGPGTGIAPFRGFLQARRVQKQKGMKVGEAHLYFGCRHPEKDYL
YRTELENDERDGLISLHTAFSRLEGHPKTYVQHVIKQDRIHLISLLDNGAHFYICGDGSK
MAPDVEDTLCQAYQEIHEVSEQEARNWLDRLQEEGRYGKDVWAGI
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaagtatctgctattcctcagccgaaaacatatggaccgctggggaatctc
ccattaatcgacaaagataaaccgaccttatcttttatcaagatagcggaagagtatggt
cctatttttcgaatgcaaactttaagtgatgcgattattgtcgtttctggacatgaactg
gtagcagaagtgtgtgacgaaacacggttcgataaaagtatagagggtgctttagcgaag
gttcgtgcctttgctggagatggattatttacaagcgagactgacgagcctaactggaaa
aaagctcataatattttgatgcctacattcagccaacgggcaatgaaagattatcatgct
atgatggtcgatattgccgtgcaactcgttcaaaaatgggcaagactgaatccgaatgaa
aatgtagatgtcccaggggatatgactcgccttacattagatacaattggtctatgtggt
tttaattatcgatttaatagcttttatcgtgagacccctcatccttttattactagcatg
actcgtgcgctagatgaggcgatgcaccaattacagaggctggatatagaagataaactc
atgtggagaacgaaacgtcaatttcagcatgatatccaatctatgttttctttagtagat
aatattattgctgaacgtaaaagtagcgggaatcaggaagaaaatgatttgctttcccgt
atgttaaatgtgcaggatccggaaactggtgaaaaattagatgatgaaaatattcgtttc
caaattattacctttctaatagctgggcatgagacaacaagtggattgttatcttttaca
atctattttttattaaagaatccggataaattgaaaaaagcctatgaagaagtagaccgt
gttttgacagatcccactccaacataccaacaagttatgaagcttaagtatatacggatg
attttaaatgaatcactacgtctatggcctactgctccagcattcagtctctatgcaaaa
gaagatacagtaattggtggaaaatacccaattaagaaaggcgaagatcgtatttctgtt
cttattccacagctacatagggataaagacgcgtggggagacaatgtggaagaattccaa
cctgaacgatttgaagagctggataaggttcctcatcatgcttataagccatttggaaat
ggtcagcgagcatgtatcggtatgcagtttgcacttcatgaagcgacactcgtaatggga
atgcttcttcaacattttgaattcattgattatgaagactatcagctgggcgtaaaacaa
acattaacgctaaagcctggtgattttaaaattaggattgtacctcgaaatcaaactatt
agccataatactgttcttgcgcctacagaggagaaactgaaaaatcatgaaattaagcag
aaagttcagaaaatcccttctattattggagccgataatctttcgcttcttgttctgtat
ggctcggatacaggggtagcggaaggtattgcaagagaactagcagatacagctagttta
gaaggtgttcaaacggaagtggcagctcttaacgatcgaattggaagtttgccaaaagaa
ggagcggttcttattgtaacttcttcttataatggaaagccgccaagtaatgcagggcag
tttgtgcagtggctggaggaattaaaaggggatgagctaaaaggtgttcaatacgcagtt
tttggttgtggagaccataattgggctagtacctatcagcgaattccaagatacattgat
gagcaaatggcgcaaaaaggagcaacaagattttctacacgtggagaagcagatgcaagt
ggtgatttcgaggaacagctcgagcaatggaaagaaagtatgtggtctgatgcgatgaag
gcatttggattggaacttaacaaaaatattgagaaagaacgcagtacattaagtttacaa
tttgtcagccgtctcgggggatctcctcttgcgcgaacatatgaagcagtttatgcatct
atattagaaaatcgtgaacttcaatcatctagcagtgaaagaagcacgcgacatattgag
atatcattgccggaaggggctacatataaagaaggagaccaccttggggtactaccaatt
aatagtgagaaaaatgtcaaccgaattttaaaacgctttggattaaatgggaaggatcaa
gtcatattaagcgcaagtgggcgcagtgtaaatcacatacctttagacagtcctgttcgt
ttatatgaccttcttagttacagtgtcgaagtgcaagaagcagccactcgagcacaaata
cgagaaatggtgacattcacagcatgtcctcctcataaaaaggaattggaatcattattg
gaagacggagtttatcatgaacaaatattaaagaaacgtatttcaatgttagatcttctt
gaaaaatatgaggcttgtgaaattcgatttgaacgttttttagaacttcttccggcgctc
aaaccgcgttactattctatttcaagctctccactcgttgcacagaatcgtctcagcatt
acggttggtgttgtgaatgcgcctgcatggagcggggaagggacatatgaaggagtcgct
tctaattatttagctcagcttcataataaagatgaaattatctgtttcattcgaacgcca
caatcaaactttcaattacctgaaaatccagaaacaccaatcattatggttgggccaggc
actggaattgcaccattccgtggatttttacaagcgcgtcgcgttcaaaagcaaaaaggt
atgaaggtaggagaagcacatctatactttggttgtcgtcaccctgaaaaggattatctc
tatcgtacagaactagagaatgatgaaagagatgggttaatctctttacacacagctttt
tctcgtttagaaggacatcctaaaacatatgtacagcatgtaataaaacaagatagaatc
catttaatttcgttattagataatggagctcatttttatatatgtggtgatggaagtaaa
atggctcctgacgtagaagataccctttgtcaagcatatcaagaaattcatgaagtcagt
gaacaagaagcaaggaattggttggaccgtctgcaagaggaaggacgatatggaaaagat
gtttgggctggtatataa

DBGET integrated database retrieval system