KEGG   Bacillus cereus ZK: BCZK3221Help
Entry
BCZK3221          CDS       T00198                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcz  Bacillus cereus ZK
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCZK3221
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCZK3221
  Lipid metabolism
   00071 Fatty acid degradation
    BCZK3221
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCZK3221
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCZK3221
   00626 Naphthalene degradation
    BCZK3221
Enzymes [BR:bcz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCZK3221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3342359..3343357
Genome map
AA seq 332 aa AA seqDB search
MKAMIIDKYGKVPMRMAEVPIPEINEHEVLAEIYAASINPIDFKIRDGKVKMLLKYEMPL
ILGNDFAGVIIKVGSKVTRFKVGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEE
AASIPLVGLTSYQALHDIMQLQKDQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGS
DLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFDIIKSGGSIVSVSGMPNA
RFGKEFGSGFFKTFLFSLASKKLTALEKKHNAQYSFLFMKPSGDQLRIIANYIEAGKIKP
VIDRVFPFEDAQKAMEYSEAGRAKGKIIVKMK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatgataattgataagtacggaaaagttccaatgcgtatggccgaggtacct
attcctgaaataaatgagcatgaagtgctcgcagaaatttatgcagctagtattaaccca
attgattttaaaatacgcgatggaaaagtaaagatgttacttaaatatgaaatgccccta
atccttgggaatgactttgccggtgtcatcataaaggttggatccaaagtaactcgtttt
aaagtcggtgatgaaatatatgcacgtccaagaaaaaataagattggtactttcgcggag
tatatagccattcatgaagatgatatagctttaaaaccgaaaaatttaagttttgaagaa
gctgcttcaattccacttgttggcttaacatcataccaagcattacatgacattatgcaa
ttacaaaaagatcaaaagattttaattcacgctggatctggtggtgttggtactttcgca
attcagttagcaaaaataatgggcgctaccgttacaacaactgctagtgaagctggttcc
gatttagtaaagtctcttggagcagatcaaattattaattacaaaacagaaaaatttgaa
gaaatactaaaagattatgatgcagtatttgataccattggtggtacaacacttgaaaaa
tcattcgatattataaaaagcggcggcagcattgtttccgtttcaggaatgccaaatgct
cgtttcggtaaagaattcggttctggattttttaaaacattcttattttcattagcaagt
aaaaaacttactgcacttgaaaaaaagcataatgctcaatattcatttttatttatgaag
ccaagcggggatcaattacgtattatcgcaaattatattgaagccggaaaaatcaaaccg
gtaatcgatcgcgttttcccttttgaagatgcgcaaaaagcaatggaatattcagaggcc
ggaagagcaaaaggaaaaataattgtaaaaatgaaataa

DBGET integrated database retrieval system