KEGG   Bacillus cereus ZK: BCZK3498Help
Entry
BCZK3498          CDS       T00198                                 

Gene name
ogt
Definition
methylated-DNA--protein-cysteine S-methyltransferase (EC:2.1.1.63)
Orthology
K13531  
methylated-DNA-[protein]-cysteine S-methyltransferase [EC:2.1.1.63]
Organism
bcz  Bacillus cereus ZK
Brite
Enzymes [BR:bcz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.63  methylated-DNA---[protein]-cysteine S-methyltransferase
     BCZK3498 (ogt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3622937..3623467
Genome map
AA seq 176 aa AA seqDB search
MNSYKNNYIYWTLLTHANWKFHIAATETGLCFIGSQNETFEEVNIWARKKLPQHILIHSP
DYLQVYTKEIIEYLENKRETFTSPIDAYGTAFQLSVWSTVREIPYGKTYSYTEIADRIQK
PTAVRAVASAIAANPILITIPCHRVIGKNGKLTGFRGGLEMKKELLALEKLQVEFI
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaattcttacaaaaataattatatatattggacgctacttacacatgcaaattggaag
tttcatattgctgcaactgaaactggactatgtttcattggatcacaaaacgaaaccttt
gaagaagtaaatatatgggctagaaaaaaactgcctcaacatatattgatccatagtcca
gattacttacaagtatatacaaaagaaattatcgagtatttagaaaacaagagagaaacc
tttacatcccctatcgatgcttacggaactgcatttcaattatctgtttggagtacggta
cgtgaaattccttatggaaaaacatattcttatacagaaattgcagatagaattcaaaaa
cctacagcggtacgtgccgttgcttctgctattgctgccaacccaattctcattacgatt
ccttgccaccgtgttattggaaagaatggtaaactaactggttttagaggtggattagaa
atgaagaaagaattgcttgcattagaaaaattacaggtggaattcatatga

DBGET integrated database retrieval system