KEGG   Bacillus cereus ZK: BCZK3788Help
Entry
BCZK3788          CDS       T00198                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bcz  Bacillus cereus ZK
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BCZK3788
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BCZK3788
Enzymes [BR:bcz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BCZK3788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
3923786..3924505
Genome map
AA seq 239 aa AA seqDB search
MGNAFAKEGAKVVITDRLEERAKEAAEQLQKEGFQAIGLKCDVTSEEEIEASISQTVNHF
GSLDILINNAGMQHVSPIEDFPTEKFELLIKIMQIAPFIAIKHAFPIMKKQKYGRIINVA
SINGLVGFAGKAAYNSAKHGVIGLTKVAALEGATHRITVNALCPGYVDTPLVRNQLQDLA
TTRNVPLENVLEDVIYPLVPQKRLLQVQEIADYAMFLASEKAKGITGQAVVIDGGYTAQ
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgcttttgcaaaagaaggtgcaaaagttgttattaccgatcgtcttgaagag
cgtgcaaaagaagctgctgaacaactacaaaaagagggctttcaagctatcggcttaaaa
tgtgatgttacatccgaagaagaaatagaagcatccatttcccaaactgttaatcatttc
ggttcattagacatattaattaataacgcaggaatgcaacacgtttcaccaattgaagat
tttccaaccgaaaaattcgagctactaattaaaattatgcaaatcgctccttttatcgca
attaagcatgccttccctattatgaaaaaacaaaaatatggccgtattataaatgtagct
tccattaatggcctcgttggattcgctggaaaagctgcttataatagcgcaaaacatggc
gtaattggattaacaaaagttgctgctttagaaggggctactcaccgaattactgttaat
gcactttgtcccggttatgtcgatacccctctcgtaaggaatcaattacaagacttggcc
actacacgaaatgtaccacttgaaaatgttttagaggatgtcatttatccacttgtccca
caaaaacgcttattacaagtacaagagattgctgattatgcgatgtttttagcgagcgaa
aaagctaaaggtataactggacaagctgtcgttatcgatggtggttataccgctcaataa

DBGET integrated database retrieval system