KEGG   Bacillus cereus ZK: BCZK4115Help
Entry
BCZK4115          CDS       T00198                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bcz  Bacillus cereus ZK
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCZK4115
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCZK4115
   00620 Pyruvate metabolism
    BCZK4115
   00650 Butanoate metabolism
    BCZK4115
  Lipid metabolism
   00071 Fatty acid degradation
    BCZK4115
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCZK4115
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCZK4115
   00626 Naphthalene degradation
    BCZK4115
Enzymes [BR:bcz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCZK4115
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BCZK4115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4219929..4222532)
Genome map
AA seq 867 aa AA seqDB search
MVVKEKVVNEMQEVKEMIDTLVNNGRKALQALESFTQEQIDNIVHEMALAGVDQHMPLAK
LAVEETGRGVYEDKCIKNIFATEYIWHSIKKDKTVGIIHEDPHEEIIEIAEPVGVVAGVT
PVTNPTSTTMFKALIAIKTRNPIIFAFHPSAQNCSVAAAKTVYDAAVKAGASKHCIQWIE
KPSVEATKQLMNHEGVALVLATGGAGMVKSAYSTGKPALGVGPGNVPCYIEKSAHIKRAV
NDLILSKTFDNGMICASEQAIIVDKEIYDDVKTEMITNDCYFVTEEERRKLEKLVINENT
CAVNSDIVGKSAQYIAELVGITVPKNTKILVAEIQGIGAAYPLSREKLSPVLACVKANSL
EEGFTYCEEMLNLGGLGHSAVIHSVNKEVQKQFGLRMKACRLIVNAPSSQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVTATHLLNIKRLANRKKNMQWFKLPPKIYFEKHATAYLANM
PNISRAFIVTDPGMVEHGYVDTVTHYLRKHANDVKVEVFFEVEPDPSDETVFKGAEMMRS
FQPDVIIALGGGSAMDAAKGMWLFYEHPETTFYGIKQKFLDIRKRTCKYPELGSKAQFVA
IPTTSGTGSEVTPFAVITDKKNNIKYPLADYELTPDVAIVDPQFVMTVPPHVTADTGMDV
LTHAIEAYVSVLANDYTDGLALKAIDLVFKYLPRAFKDGHDEEAREKMHNASAIAGMAFA
NAFLGINHSLAHKIGPEFHIPHGRANAILMPHVVRYNAIKPRKHALFPKYEHFVADERYA
HIARMLGLPASSVAEGVESLVKAIIDLGKSLNINMSIAGQGVAKDQFEQVVGLLAERAFE
DQCTTANPKLPLISELKEIYMKAYKGE
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcaaagagaaagttgtaaatgaaatgcaggaagtaaaagagatgattgatacg
ttagtgaataacggtcggaaggctttacaagcattagaaagttttacacaagagcaaatt
gacaacattgttcatgaaatggcattagcaggtgttgatcaacatatgccacttgcgaaa
ttggctgttgaagaaacaggtcgtggggtatacgaagataaatgcattaaaaatattttt
gctactgaatatatttggcatagcataaagaaagataaaacagtagggattattcacgaa
gatcctcatgaagaaataatagaaattgcggagcccgtcggtgtagtagctggggtaaca
ccagtaacgaatccaacatcgacaacaatgtttaaagcattaatcgcgataaaaacgaga
aatccaattattttcgcatttcatccttcagcacaaaactgttctgttgcagccgcgaaa
acagtatatgatgcagcggtgaaggcgggggcatcaaaacattgtattcagtggattgaa
aagccttctgtcgaagcaacgaaacaattaatgaaccatgaaggtgttgcgcttgttttg
gcaactggaggggctggtatggtgaaatcagcttattctactggaaaaccagcgctaggt
gtaggtcctggtaatgtaccatgttatatagagaaatcagcgcacataaaacgagcggtt
aatgatttgattttatcaaaaacatttgataacgggatgatttgtgcatcagaacaagca
atcattgtagacaaggaaatttatgatgatgtgaaaacagaaatgattacaaatgattgt
tactttgtaacagaggaagagagaagaaaattagaaaagcttgttattaatgaaaataca
tgtgcagtaaatagtgatattgtagggaaatctgcacagtatattgccgaattagttgga
attactgtacctaaaaatacaaaaatacttgtagctgaaatacaaggcatcggagccgca
tatccactatctcgtgagaagttaagtccagtattagcttgtgtaaaagcaaattcatta
gaagaaggatttacatattgtgaagaaatgttaaacctcggtggtttagggcattcagca
gttatccattctgtaaataaagaagtgcaaaagcaatttggattacgtatgaaagcttgt
cgccttattgtaaatgctccttcatcacaaggtgggatcggtgacatatataatggattt
attccatcacttacgcttggctgcggttcctatgggaaaaactcggtttctcaaaacgta
acagcgacgcatttattaaatataaaaaggttggcaaatagaaaaaagaatatgcagtgg
ttcaaattaccaccaaaaatttattttgaaaaacatgcgacagcatatttagcaaatatg
cctaacatttcacgtgcgtttattgtaacggatccaggaatggttgagcacggatatgta
gatacggttacgcattatttacgtaaacatgcaaatgatgtgaaagttgaagttttcttt
gaggtcgagccagatccgtcagatgaaactgtgtttaaaggtgcggaaatgatgagaagt
tttcagcctgatgtcattatcgcacttggtggtggttcagcgatggatgcagcgaaaggg
atgtggcttttctatgagcacccagaaacaacattctatggaattaaacagaagttttta
gatataagaaaacgtacatgtaaatatccggaattaggaagtaaggcgcagtttgttgct
attccaacaacatctggaacaggatcagaagtgacaccatttgcggttattacagataag
aaaaataatataaagtatccacttgcagattatgaattaacgccagatgtagcaattgtt
gatccacaatttgtaatgacagtaccaccacatgtaacagcagacactgggatggacgta
ttaacgcatgcaatcgaggcgtatgtgtctgttttagcaaatgactatacagatggatta
gcactaaaggctattgatctcgtatttaaatatttaccaagagcatttaaagatggacat
gatgaagaagcacgagaaaaaatgcataatgcttctgcaattgcagggatggcatttgca
aatgctttcctaggtattaatcacagtttagcacataaaattggaccagaatttcatatt
ccgcatgggcgtgcgaatgcaattcttatgccgcacgtagttcgctataatgctattaag
ccaagaaaacacgcattgttcccaaaatatgagcattttgtagctgatgaacgctatgca
catattgcgagaatgctcgggctaccagcaagttcggtggcagaaggtgtagaatcactc
gtcaaagcaattattgatctcggaaaaagtttaaatataaatatgagtattgcgggacaa
ggagttgctaaagaccaatttgaacaggttgttggattattagcagaaagagcttttgaa
gatcaatgtacaacagctaatccgaaattacctctcatttcagagctgaaagaaatttat
atgaaagcatataaaggtgagtaa

DBGET integrated database retrieval system