KEGG   Bacillus cereus ZK: BCZK4389Help
Entry
BCZK4389          CDS       T00198                                 

Gene name
acsA
Definition
acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcz  Bacillus cereus ZK
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bcz01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bcz00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bcz00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bcz00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bcz00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(4496832..4498418)
Genome map
AA seq 528 aa AA seqDB search
MKREELLAPPSYNLVSEIEKYTGDKEKLALIWQDDKGNRREVTYAELMKGANKIGNAFIK
SGLQKGDKLLIMMPRLIEAYMTYIAAIKAGFVVIPSSEMLRKKDIEYRIGHGEVKAIVSY
EPYIGQFDDIEAMESLQKFVLSEQSVDGWMNLKTALETESDMFEMAKTDKEDMVFLSYTS
GTTGNPKGVVHTHAWAYAHLRTSAPNWLGIEENDVVWATASPGWQKWIWSPFLATLGSGA
TGFVYHGKFEPKTYLNLLDDNKVNVLCCTPTEYRLMAKVENLSEYNLEALHSAVSAGEPL
NREVIETFQKYFHITVRDGYGQTENTLLVGVMKGMDIRPGSMGKPTPGNHVDIVDEEGMP
VRVGEVGDIAVHIETPALFKQYYKDDERTAMQFRGDYYITGDKAKKDEDGYFWFEGRGDD
IIISSGYTIGPFEVEDALVKHPYVRECAVVASPDEIRGSVVKAFIVLRENIEKNEETLIP
ILQQHVKELTAPYKYPRKIEFVDELPKTISGKIRRIELRKQEMEIPSK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagaggaattgttggcaccaccgtcttataatttagtttctgaaatagagaaa
tatacaggtgataaagagaagcttgctttaatttggcaagatgataaagggaatcgacga
gaagttacatacgctgagttaatgaaaggtgcaaataaaattggaaacgcttttataaag
agtggtctgcaaaaaggggacaaactcctcattatgatgccgcgtttaattgaagcgtac
atgacgtatatcgcagcgattaaagcaggatttgtcgtaattccgagttcagaaatgtta
cgcaaaaaggatatcgaatatcgcattggacacggggaagtaaaagcaatcgtaagttat
gagccttacattggacagtttgatgatatagaagcgatggaatctcttcaaaaattcgtt
ctgagcgagcagtcagtagatggatggatgaatttaaaaacagcgttagaaacagaaagt
gacatgtttgagatggcaaagacagataaagaagatatggtctttttatcgtatacgtca
ggaacgacaggaaatccaaaaggtgttgttcatacgcatgcgtgggcatacgctcactta
cgtacgagcgctccaaattggctcggaattgaagagaatgatgttgtatgggcaacggct
agtccaggatggcaaaagtggatttggagcccgtttttagcaactctaggctcgggggca
acaggatttgtataccacggtaagtttgaaccaaaaacgtatttaaatttattagacgat
aataaggtgaatgtgctttgttgtacgccaactgagtatagattaatggcaaaggtagaa
aatttaagcgagtacaatttagaagcgttacatagcgctgtatccgcaggtgagccgtta
aatagagaagtcattgaaacgttccaaaagtactttcatattacagtgagagacggctat
gggcaaacggaaaacacattgcttgttggtgtaatgaaagggatggatattagaccagga
tcaatggggaaaccgacgccaggcaaccacgttgatattgtagatgaggaagggatgccg
gtaagggtaggagaagttggtgatattgcggttcacattgaaacaccagccctctttaaa
caatactataaagacgatgagcgcacagcgatgcaattccgcggtgattattatattacc
ggtgataaagcaaagaaagatgaagacggctatttctggtttgaagggcgcggtgatgat
attattattagctctggttatacaatcgggccgtttgaagtagaagatgcgctcgtaaaa
cacccttacgtgagagaatgtgcggttgtcgcaagtcctgatgaaattcgcggaagtgtc
gtgaaggcatttatcgtattgagagagaatatagaaaagaacgaagaaacattaattcca
atactccaacaacacgtcaaagaacttacagcaccatataaataccctcgcaaaattgaa
tttgtagatgaactaccaaaaacgatttctggaaaaatccgccgtattgaacttagaaaa
caagagatggagattccgtcaaaataa

DBGET integrated database retrieval system