KEGG   Bacillus cereus ZK: BCZK4510Help
Entry
BCZK4510          CDS       T00198                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bcz  Bacillus cereus ZK
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BCZK4510
Enzymes [BR:bcz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BCZK4510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(4605535..4606368)
Genome map
AA seq 277 aa AA seqDB search
MKKSEMEESRMWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGT
TSRNRGHIDSFDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVDGII
LSSPCLGVLAGPSAPLQAASKILNIIAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRK
VSVRWYSELTKSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRTWFDNVKISDKAFKE
WPNCYHELLNEYERDEILNYIQSFTEIRINNIIETNK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagagtgaaatggaggaaagccgtatgtggaattatgaagctgaagaagcaaag
gctgtaatcgttatcgtgcacggcgcaatggaatatcacgggcgttatgaagctgttgcg
gaaatgtggaatcatatcggctatcacgtcgtgatgggggaccttccgtcacatggaacg
acttcaagaaatagaggacatattgattcgtttgatgaatacatagaggaagttaaatta
tgggtgaaagaggcaagaaagtatcggttacctatttttctatttggtcatagtatgggt
ggtcttattgtcattcgtatgatgcaagagacgaagagagaagatgtagacggcattatt
ttaagttcgccatgtttaggtgtattagctggaccttctgcaccgcttcaagctgcctca
aaaatattaaatattatcgctccgaagttacaatttgcaacgaatcttacagtggaaatg
tcaacgcgtaatcatgaagtgagagatgcgatggagaacgattcattgttcttgcgcaaa
gtatcagtacgttggtatagtgaattgactaagtctattgaaatcgctcataaaaaaata
gatgattttccagatgttccgctcttgctaatgcaagcatgtgaggataaacttgtagat
aaaacacgtgtccgcacttggtttgataatgttaaaataagtgataaggcttttaaagaa
tggccgaattgttatcatgagttattaaatgagtatgagcgtgatgaaattttgaattat
attcagtcatttactgaaatacgcatcaataacataatagaaacaaataagtaa

DBGET integrated database retrieval system