KEGG   Bacillus cereus ZK: BCZK4696Help
Entry
BCZK4696          CDS       T00198                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcz  Bacillus cereus ZK
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCZK4696 (gpmA)
   01230 Biosynthesis of amino acids
    BCZK4696 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCZK4696 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BCZK4696 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCZK4696 (gpmA)
Enzymes [BR:bcz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCZK4696 (gpmA)
Exosome [BR:bcz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCZK4696 (gpmA)
  Exosomal proteins of melanoma cells
   BCZK4696 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4793289..4793843
Genome map
AA seq 184 aa AA seqDB search
MKKIIVIRHCSATGQERDAELTTDGKNQANTLATFLLEQHPQIDHIISSPFVRAIDSIRP
YALQANLPIQKDERLAERLLSDVPMDDWMQKLESTFTNIDIAFSGGESTKQAMDRAISLI
EDILQLNHTTTLLVTHGNLLTLILKHFDHTIGFNEWRTLTNPDMYEITIDEQCRLKRLWE
APSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcattgtaatacgacattgttcagcaactggccaagaacgtgatgccgaa
ttaacgacggatgggaaaaaccaagcaaacacccttgctacattcctcttagagcaacat
ccacaaatagaccatattatttcaagcccatttgtgcgagctatcgattctattcggccc
tatgcgctccaagctaacttgcctatacaaaaagatgaacgactagctgaacgcttatta
agtgacgttccaatggacgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttctggcggagagtcaacgaaacaagcaatggaccgtgctatatcgcttatc
gaagacattttacaattaaaccatactacaacattactcgttacacatggaaacttactt
acgctcattttaaagcactttgatcatacaatcggctttaatgaatggagaactttaacg
aatcctgatatgtacgaaattacaatcgatgaacaatgtaggctaaaacgattatgggaa
gcaccttccaagtaa

DBGET integrated database retrieval system